General Information

  • ID:  hor000867
  • Uniprot ID:  Q8MJW9
  • Protein name:  Endothelin-2
  • Gene name:  EDN2
  • Organism:  Mustela putorius furo (European domestic ferret) (Mustela furo)
  • Family:  Endothelin/sarafotoxin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Mustela putorius (species), Mustela (genus), Mustelinae (subfamily), Mustelidae (family), Caniformia (suborder), Carnivora (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0031708 endothelin B receptor binding
  • GO BP:  GO:0001516 prostaglandin biosynthetic process; GO:0001525 angiogenesis; GO:0001659 temperature homeostasis; GO:0001944 vasculature development; GO:0002690 positive regulation of leukocyte chemotaxis; GO:0003100 regulation of systemic arterial blood pressure by endothelin; GO:0006939 smooth muscle contraction; GO:0008284 positive regulation of cell population proliferation; GO:0009932 cell tip growth; GO:0010460 positive regulation of heart rate; GO:0014824 artery smooth muscle contraction; GO:0014826 vein smooth muscle contraction; GO:0019221 cytokine-mediated signaling pathway; GO:0019229 regulation of vasoconstriction; GO:0030593 neutrophil chemotaxis; GO:0031175 neuron projection development; GO:0042116 macrophage activation; GO:0042310 vasoconstriction; GO:0043542 endothelial cell migration; GO:0045987 positive regulation of smooth muscle contraction; GO:0048246 macrophage chemotaxis; GO:0048286 lung alveolus development; GO:0048675 axon extension; GO:0050850 positive regulation of calcium-mediated signaling; GO:0097009 energy homeostasis; GO:0097746 blood vessel diameter maintenance
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  CSCSSWLDKECVYFCHLDIIW
  • Length:  21
  • Propeptide:  MVAVPTAWCSVALALLLALQEGKGQVAAAPDHPAPSPRARGSHLRPRRCSCSSWLDKECVYFCHLDIIWVNTPGQTAPYGLGNPPRRRRRSLPKRCECSSSGDPACATFCHRRPWAEAVVVPGSRSPADVFQAGQRWTSAGELLQQLREISATKIRFARQHQEAEREPRPMYPRRRKT
  • Signal peptide:  MVAVPTAWCSVALALLLALQEGKG
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Endothelium-derived vasoconstrictor peptides
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  EDNRA, EDNRB
  • Target Unid:  M3Y6H8, M3XW47
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  1-15; 3-11
  • Structure ID:  AF-Q8MJW9-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor000867_AF2.pdbhor000867_ESM.pdb

Physical Information

Mass: 290790 Formula: C115H164N26O32S4
Absent amino acids: AGMNPQRT Common amino acids: C
pI: 4.37 Basic residues: 2
Polar residues: 8 Hydrophobic residues: 8
Hydrophobicity: 50 Boman Index: -832
Half-Life: 1.2 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 88.1
Instability Index: 6531.9 Extinction Coefficient cystines: 12740
Absorbance 280nm: 637

Literature

  • PubMed ID:  NA
  • Title:  NA