General Information

  • ID:  hor000856
  • Uniprot ID:  P97740
  • Protein name:  Endothelin-1
  • Gene name:  EDN1
  • Organism:  Cavia porcellus (Guinea pig)
  • Family:  Endothelin/sarafotoxin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Cavia (genus), Caviidae (family), Hystricomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0019229 regulation of vasoconstriction; GO:0042310 vasoconstriction; GO:0086100 endothelin receptor signaling pathway; GO:0097746 blood vessel diameter maintenance; GO:1900182 positive regulation of protein localization to nucleus
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  CSCSSLMDKECVYFCHLDIIW
  • Length:  21
  • Propeptide:  AAETVVSGAELSLTANSGGEKTPPHAPGLLRRSKRCSCSSLMDKECVYFCHLDIIWVNTPGHIAPYGLGGPFRSKRSLKELFPTKATEHRNRCQCANQKDKKCWNFCQAGKELSSQDTMQKGWDNHKKGKDCSKLGKKCISQQLGNGKK
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  endothelium-derived vasoconstrictor peptides
  • Mechanism:  activates PTK2B, BCAR1, BCAR3 and, GTPases RAP1 and RHOA cascade in glomerular mesangial cells
  • Cross BBB:  YES
  • Target:  Ednrb, EDNRA
  • Target Unid:  H0VTF3, H0V3E9
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: 40 seconds; /40 seconds ( PubMed ID: 2182027 )

Structure

  • Disulfide bond:  1-15; 3-11
  • Structure ID:  AF-P97740-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor000856_AF2.pdbhor000856_ESM.pdb

Physical Information

Mass: 285288 Formula: C109H163N25O32S5
Absent amino acids: AGNPQRT Common amino acids: C
pI: 4.37 Basic residues: 2
Polar residues: 8 Hydrophobic residues: 7
Hydrophobicity: 63.33 Boman Index: -830
Half-Life: 1.2 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 88.1
Instability Index: 5944.29 Extinction Coefficient cystines: 7240
Absorbance 280nm: 362

Literature

  • PubMed ID:  2182027
  • Title:  NA