HORDB

ID: hor000855
Uniprot ID: Q765Z4
Protein name: Endothelin-3
Gene name: EDN3
Organism: Canis lupus familiaris (Dog) (Canis familiaris)
Family: Endothelin/sarafotoxin family
Source: animal
Expression: Expressed in which included heart, lung, liver, kidney, spleen, stomach, pancreas, duodenum, colon, uterus, ovary and testis.
Disease: NA
Comments: NA
Taxonomy: Canis lupus (species), Canis (genus), Canidae (family), Caniformia (suborder), Carnivora (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0005179 hormone activity; GO:0031708 endothelin B receptor binding
GO BP: GO:0003100 regulation of systemic arterial blood pressure by endothelin; GO:0006874 intracellular calcium ion homeostasis; GO:0007165 signal transduction; GO:0014826 vein smooth muscle contraction; GO:0019229 regulation of vasoconstriction; GO:0042310 vasoconstriction; GO:0097746 blood vessel diameter maintenance
GO CC: GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence: CTCFTYKDKECVYYCHLDIIW
Length: 21
Propeptide: MEPGLWLLFGLTVTSAAGLVPCPQPGDAGKSGVPGTPPTARSEGDIQEPVAMTAVQGPSPRSPEQEQELGRFGEQASKGGPVHGRARRCTCFTYKDKECVYYCHLDIIWINTPEQTVPYGLSNYRGSFRGRRSTGLFPQSPQPSKWTQRCACVQSQDSACLHFCTRTLAVSRNSRTATNPDKEEEPASRGNGGLRPTR
Signal peptide: MEPGLWLLFGLTVTSA
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor000855_AF2.pdb

hor000855_ESM.pdb

Mass:	300403	Formula:	C121H172N26O33S4
Absent amino acids:	AGMNPQRS	Common amino acids:	C
pI:	5.51	Basic residues:	3
Polar residues:	9	Hydrophobic residues:	6
Hydrophobicity:	10	Boman Index:	-1634
Half-Life:	1.2 hour	Half-Life Yeast:	>20 hour
Half-Life E.Coli:	>10 hour	Aliphatic Index	69.52
Instability Index:	5614.76	Extinction Coefficient cystines:	10220
Absorbance 280nm:	511