HORDB

ID: hor000852
Uniprot ID: Q867A9
Protein name: Endothelin-2
Gene name: EDN2
Organism: Bos taurus (Bovine)
Family: Endothelin/sarafotoxin family
Source: animal
Expression: Expressed in various organs including heart, lung, liver, kidney, gastrointestinal tract, uterus and ovary, but not in spleen. Within the gastrointestinal tract, gene expression was detected in rumen, a ruminant-specific digestive organ, as well as stomac
Disease: NA
Comments: NA
Taxonomy: Bos (genus), Bovinae (subfamily), Bovidae (family), Pecora (infraorder), Ruminantia (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0005179 hormone activity; GO:0031708 endothelin B receptor binding
GO BP: GO:0003100 regulation of systemic arterial blood pressure by endothelin; GO:0006874 intracellular calcium ion homeostasis; GO:0007165 signal transduction; GO:0014826 vein smooth muscle contraction; GO:0019229 regulation of vasoconstriction; GO:0042310 vasoconstriction; GO:0097746 blood vessel diameter maintenance
GO CC: GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence: CSCSSWLDKECVYFCHLDIIW
Length: 21
Propeptide: MPTALCSIALALLVALHEGKSQAATTPIPEQPAPLPRARGSHLRTRRCSCSSWLDKECVYFCHLDIIWVNTPGQTAPYGLGNPPRRRRRSLPRRCECYSARDPACATFCHQRPWTDAVAVPGSGSPAAAFQDGKTQATAGELLQRLRVISATKIHFARQQQKPTRETRPTHSRQRKR
Signal peptide: MPTALCSIALALLVALHEGKSQA
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor000852_AF2.pdb

hor000852_ESM.pdb

Mass:	290790	Formula:	C115H164N26O32S4
Absent amino acids:	AGMNPQRT	Common amino acids:	C
pI:	4.37	Basic residues:	2
Polar residues:	8	Hydrophobic residues:	8
Hydrophobicity:	50	Boman Index:	-832
Half-Life:	1.2 hour	Half-Life Yeast:	>20 hour
Half-Life E.Coli:	>10 hour	Aliphatic Index	88.1
Instability Index:	6531.9	Extinction Coefficient cystines:	12740
Absorbance 280nm:	637