General Information

  • ID:  hor000830
  • Uniprot ID:  Q9GSA4
  • Protein name:  Corazonin precursor-related peptide
  • Gene name:  crz
  • Organism:  Galleria mellonella (Greater wax moth)
  • Family:  Corazonin family
  • Source:  Animal
  • Expression:  Four pairs of lateral neurosecretory cells in the brains of late instar larvae, pupae and adults.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Galleria (genus), Galleriinae (subfamily), Pyralidae (family), Pyraloidea (superfamily), Obtectomera, Ditrysia, Heteroneura (parvorder), Neolepidoptera (infraorder), Glossata (suborder), Lepidoptera (order), Amphiesmenoptera (superorder), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005184 neuropeptide hormone activity; GO:0071858 corazonin receptor binding
  • GO BP:  GO:0007218 neuropeptide signaling pathway; GO:0045823 positive regulation of heart contraction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  DGHKTEDIRDLTNNLERILSPCQMNKLKYVLEGKPLNERLLGPCDTSKTRSTTNPSDTNTSAVKTPCSTHFNKHCYSFSY
  • Length:  80(34-113)
  • Propeptide:  MATNITMFLIVITLTSVAAQTFQYSRGWTNGKRDGHKTEDIRDLTNNLERILSPCQMNKLKYVLEGKPLNERLLGPCDTSKTRSTTNPSDTNTSAVKTPCSTHFNKHCYSFSY
  • Signal peptide:  MATNITMFLIVITLTSVAA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Be involved in the physiological regulation of the heart beat
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q9GSA4-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor000830_AF2.pdbhor000830_ESM.pdb

Physical Information

Mass: 1047241 Formula: C387H619N113O128S5
Absent amino acids: W Common amino acids: T
pI: 8.33 Basic residues: 14
Polar residues: 35 Hydrophobic residues: 15
Hydrophobicity: -92.25 Boman Index: -21335
Half-Life: 1.1 hour Half-Life Yeast: 3 min
Half-Life E.Coli: >10 hour Aliphatic Index 57.25
Instability Index: 2141 Extinction Coefficient cystines: 4720
Absorbance 280nm: 59.75

Literature

  • PubMed ID:  NA
  • Title:  NA