General Information

  • ID:  hor000816
  • Uniprot ID:  Q86N75
  • Protein name:  Corazonin precursor-related peptide
  • Gene name:  crz
  • Organism:  Bombyx mori (Silk moth)
  • Family:  Corazonin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Bombyx (genus), Bombycinae (subfamily), Bombycidae (family), Bombycoidea (superfamily), Obtectomera, Ditrysia, Heteroneura (parvorder), Neolepidoptera (infraorder), Glossata (suborder), Lepidoptera (order), Amphiesmenoptera (superorder), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005184 neuropeptide hormone activity; GO:0071858 corazonin receptor binding
  • GO BP:  GO:0007218 neuropeptide signaling pathway; GO:0045823 positive regulation of heart contraction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  DGHKRDELRDEVLERILTPCQLDKLKYVLEGKPLNDRLFVPCDYIEEEVNQPKRYKGERNHELFDVFQ
  • Length:  68(34-101)
  • Propeptide:  MVTNITLILTLMTLASVTAQTFQYSRGWTNGKRDGHKRDELRDEVLERILTPCQLDKLKYVLEGKPLNDRLFVPCDYIEEEVNQPKRYKGERNHELFDVFQ
  • Signal peptide:  MVTNITLILTLMTLASVTA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Be involved in the physiological regulation of the heart beat
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q86N75-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor000816_AF2.pdbhor000816_ESM.pdb

Physical Information

Mass: 942657 Formula: C365H574N102O111S2
Absent amino acids: AMSW Common amino acids: EL
pI: 4.87 Basic residues: 14
Polar residues: 12 Hydrophobic residues: 19
Hydrophobicity: -100.59 Boman Index: -20536
Half-Life / Aliphatic Index: 1.1 hour Aliphatic Index: 84.41
Instability Index: 4165.15 Extinction Coefficient cystines: 4595
Absorbance 280nm: 68.58

Literature

  • PubMed ID:  NA
  • Title:  NA