General Information

  • ID:  hor000783
  • Uniprot ID:  O35314
  • Protein name:  CCB peptide short form
  • Gene name:  Chgb
  • Organism:  Rattus norvegicus (Rat)
  • Family:  Chromogranin/secretogranin protein family
  • Source:  animal
  • Expression:  First expressed in the brain around embryonic days 13-14, and peaks by postnatal day 20. |Expressed in the brain, adrenal medulla and anterior pituitary. In the brain, localized to the hippocampal formation, the endocrine hypothalamus, the olfactory syste
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Rattus (genus), Murinae (subfamily), Muridae (family), Muroidea, Myomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  NA
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0030141 secretory granule

Sequence Information

  • Sequence:  AAEFPDFYDSEEQMGPHQEAEDEKDRADQRVLTEEEKKELENLAAMDLELQKIAEKFSQR
  • Length:  60
  • Propeptide:  MQRAMLLGLLGAAALAAVISAPVDNRDHNEEMVTRCIIEVLSNALSKSSAPTITPECRQVLRKSGKEVKGEEKGENENSKFEVRLLRDPSDASVGRWASSREETGAPVEDSPGQAKVDNEEWTGGGGHSREAVDDQESLHPSNQQVSKEAKIRHSEERGGKEEEEEEGKIYPKGEHRGDAGEEKKHTEESGEKHNAFSNKRSEASAKKKEESVARAEAHFVELEKTHSREQSSQESGEETRRQEKPQELPDQDQSEEESEEGEEGEEGATSEVTKRRPRHHHWRSQSNKPSYEGRRPLSEERKHAAGESKDANVATANLGEKRGHHLAHYRASEEEPDYGEELRSYPGFQAPQGLQYQGRGSEEVRAPSPRSEESQEKEYKRNHPDSELESTANRHSEETEEERSYEGAKGRQHRGRGREPGAYPALDSRQEKRLLDEGHDPVHESPVDTAKRYPQSKWQEQEKNYLNYDEEGDQGRWWQQEEQLEPEESREEVSFPDRQYAPYPTTEKRKRLGALFNPYFDPLQWKNSDFEKKGNPDDSFLDDDGEDGNGVTMTEKNFFPEYNYDWWEKRPFSEDVNWGYEKRSFARAPHLDLKRQYDDGVAELDQLLHYRKKAAEFPDFYDSEEQMGPHQEAEDEKDRADQRVLTEEEKKELENLAAMDLELQKIAEKFSQRG
  • Signal peptide:  MQRAMLLGLLGAAALAAVIS
  • Modification:  T8 Sulfotyrosine;T10 Phosphoserine;T60 Arginine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Secretogranin-1 is a neuroendocrine secretory granule protein, which may be the precursor for other biologically active peptides.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-O35314-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor000783_AF2.pdbhor000783_ESM.pdb

Physical Information

Mass: 811023 Formula: C302H470N82O109S2
Absent amino acids: CW Common amino acids: E
pI: 4.02 Basic residues: 9
Polar residues: 6 Hydrophobic residues: 17
Hydrophobicity: -130.67 Boman Index: -20106
Half-Life: 4.4 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 55.5
Instability Index: 6002.67 Extinction Coefficient cystines: 1490
Absorbance 280nm: 25.25

Literature

  • PubMed ID:  18181560
  • Title:  A Sulfated, Phosphorylated 7 kDa Secreted Peptide Characterized by Direct Analysis of Cell Culture Media