General Information

  • ID:  hor000740
  • Uniprot ID:  P47868
  • Protein name:  SCG3 38-53
  • Gene name:  Scg3
  • Organism:  Rattus norvegicus (Rat)
  • Family:  Chromogranin/secretogranin protein family
  • Source:  animal
  • Expression:  Expression restricted to the brain and pituitary gland. Not detected in the adrenal gland.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Rattus (genus), Murinae (subfamily), Muridae (family), Muroidea, Myomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005515 protein binding
  • GO BP:  GO:0033366 protein localization to secretory granule
  • GO CC:  GO:0005576 extracellular region; GO:0016020 membrane; GO:0030133 transport vesicle; GO:0030658 transport vesicle membrane; GO:0030667 secretory granule membrane; GO:0031410 cytoplasmic vesicle

Sequence Information

  • Sequence:  ELSAERPLNEQIAEAE
  • Length:  16
  • Propeptide:  MGFLWTGSWILVLVLNSGPIQAFPKPEGSQDKSLHNRELSAERPLNEQIAEAEADKIKKTYPSESKPSESNFSSVDNLNLLKAITEKETVEKAKQSIRSSPFDNRLNVDDADSTKNRKLTDEYDSTKSGLDRKVQDDPDGLHQLDGTPLTAEDIVHKIATRIYEENDRGVFDKIVSKLLNLGLITESQAHTLEDEVAEALQKLISKEANNYEEAPEKPTSRTENQDGKIPEKVTPVAATQDGFTNRENDDTVSNTLTLSNGLERRTNPHRDDDFEELQYFPNFYALLTSIDSEKEAKEKETLITIMKTLIDFVKMMVKYGTISPEEGVSYLENLDETIALQTKNKLEKNTTDSKSKLFPAPPEKSHEETDSTKEEAAKMEKEYGSLKDSTKDDNSNLGGKTDEAKGKTEAYLEAIRKNIEWLKKHNKKGNKEDYDLSKMRDFINQQADAYVEKGILDKEEANAIKRIYSSL
  • Signal peptide:  MGFLWTGSWILVLVLNSGPIQA
  • Modification:  T3 Phosphoserine
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Member of the granin protein family that regulates the biogenesis of secretory granules (PubMed:12388744, PubMed:14597614). Acts as a sorting receptor for intragranular proteins including chromogranin A/CHGA (PubMed:12388744, PubMed:14597614). May also play a role in angiogenesis. Promotes endothelial proliferation, migration and tube formation through MEK/ERK signaling pathway (By similarity).
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P47868-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor000740_AF2.pdbhor000740_ESM.pdb

Physical Information

Mass: 206666 Formula: C75H123N21O30
Absent amino acids: CDFGHKMTVWY Common amino acids: E
pI: 3.71 Basic residues: 1
Polar residues: 2 Hydrophobic residues: 6
Hydrophobicity: -86.88 Boman Index: -4436
Half-Life: 1 hour Half-Life Yeast: 30 min
Half-Life E.Coli: >10 hour Aliphatic Index 91.88
Instability Index: 3345 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  23410195
  • Title:  Neurotoxin-Induced Neuropeptide Perturbations in Striatum of Neonatal Rats