HORDB

ID: hor000730
Uniprot ID: Q03517
Protein name: Secretogranin 2
Gene name: Scg2
Organism: Mus musculus (Mouse)
Family: Chromogranin/secretogranin protein family
Source: animal
Expression: NA
Disease: NA
Comments: NA
Taxonomy: Mus (subgenus), Mus (genus), Murinae (subfamily), Muridae (family), Muroidea, Myomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0005125 cytokine activity; GO:0042056 chemoattractant activity
GO BP: GO:0000165 MAPK cascade; GO:0001525 angiogenesis; GO:0001938 positive regulation of endothelial cell proliferation; GO:0035556 intracellular signal transduction; GO:0048245 eosinophil chemotaxis; GO:0050918 positive chemotaxis; GO:0050930 induction of positive chemotaxis; GO:2000352 negative regulation of endothelial cell apoptotic process; GO:2001237 negative regulation of extrinsic apoptotic signaling pathway
GO CC: GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0030141 secretory granule; GO:0031045 dense core granule; GO:0098992 neuronal dense core vesicle

Sequence: ESKDQLSEDASKVITYL
Length: 17
Propeptide: MAGAKAYRLGAVLLLIHLIFLISGAEAASFQRNQLLQKEPDLRLENVQKFPSPEMIRALEYIEKLRQQAHREESSPDYNPYQGVSVPLQLKENGEESHLAESSRDALSEDEWMRIILEALRQAENEPPSAPKENKPYALNLEKNFPVDTPDDYETQQWPERKLKHMRFPLMYEENSRENPFKRTNEIVEEQYTPQSLATLESVFQELGKLTGPSNQKRERVDEEQKLYTDDEDDVYKTNNIAYEDVVGGEDWSPIEEKIETQTQEEVRDSKENTEKNEQINEEMKRSGQLGLPDEENRRESKDQLSEDASKVITYLRRLVNAVGSGRSQSGPNGDRAARLLQKPLDSQSIYQLIEISRNLQIPPEDLIEMLKAGEKPNGLVEPEQDLELAVDLDDIPEADLDRPDMFQSKMLSKGGYPKAPGRGMVEALPDGLSVEDILNVLGMENVVNQKSPYFPNQYSQDKALMRLPYGPGKSRANQIPKVAWIPDVESRQAPYENLNDQELGEYLARMLVKYPELLNTNQLKRVPSPVSSEDDLQEEEQLEQAIKEHLGPGSSQEMERLAKVSKRIPVGSLKNEDTPNRQYLDEDMLLKVLEYLNQEQAEQGREHLAKRAMENM
Signal peptide: MAGAKAYRLGAVLLLIHLIFLISGAEAASF
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Function: Neuroendocrine protein of the granin family that regulates the biogenesis of secretory granules.
Mechanism: Binds calcium with a low-affinity.
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor000730_AF2.pdb

hor000730_ESM.pdb

Mass:	221168	Formula:	C83H136N20O32
Absent amino acids:	CFGHMNPRW	Common amino acids:	S
pI:	4.11	Basic residues:	2
Polar residues:	5	Hydrophobic residues:	5
Hydrophobicity:	-68.24	Boman Index:	-4000
Half-Life:	1 hour	Half-Life Yeast:	30 min
Half-Life E.Coli:	>10 hour	Aliphatic Index	91.76
Instability Index:	3840.59	Extinction Coefficient cystines:	1490
Absorbance 280nm:	93.13