General Information

  • ID:  hor000720
  • Uniprot ID:  D2J4U0
  • Protein name:  Cardioactive peptide
  • Gene name:  NA
  • Organism:  Rhodnius prolixus (Triatomid bug)
  • Family:  NA
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Rhodnius (genus), Triatominae (subfamily), Reduviidae (family), Reduvioidea (superfamily), Cimicomorpha (infraorder), Panheteroptera, Neoheteroptera, Euheteroptera, Heteroptera (suborder), Prosorrhyncha, Hemiptera (order), Paraneoptera (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  NA
  • GO CC:  NA

Sequence Information

  • Sequence:  PFCNAFTGC
  • Length:  9
  • Propeptide:  MQLLVPCFLLFTALVFAVLTDDVFLQKRVYFPGEIAEPIDPKMKKPFCNAFTGCGKKRSDESMATLVDLNSEPAVEELSRQILSEAKLWEAIQEARMELLNRKQQQSDRIPLQPLPLTTIRKRSHYLYT
  • Signal peptide:  MQLLVPCFLLFTALVFA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Cardioregulatory neurohormone that increases heart beat rate during adult wing inflation; has no effect on beat amplitude. The effect of CCAP is both ino- and chronotropic
  • Mechanism:  NA
  • Cross BBB:  NO
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-D2J4U0-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor000720_AF2.pdbhor000720_ESM.pdb

Physical Information

Mass: 110198 Formula: C42H58N10O12S2
Absent amino acids: DEHIKLMQRSVWY Common amino acids: CF
pI: 5.84 Basic residues: 0
Polar residues: 5 Hydrophobic residues: 3
Hydrophobicity: 68.89 Boman Index: 206
Half-Life: >20 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: ? Aliphatic Index 11.11
Instability Index: 2085.56 Extinction Coefficient cystines: 125
Absorbance 280nm: 15.63

Literature

  • PubMed ID:  21875591
  • Title:  Crustacean Cardioactive Peptide in the Chagas' Disease Vector, Rhodnius Prolixus: Presence, Distribution and Physiological Effects