General Information

  • ID:  hor000707
  • Uniprot ID:  Q9BDP9
  • Protein name:  CART(62-102)
  • Gene name:  CARTPT
  • Organism:  Sus scrofa (Pig)
  • Family:  CART family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Sus (genus), Suidae (family), Suina (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005184 neuropeptide hormone activity
  • GO BP:  GO:0001678 intracellular glucose homeostasis; GO:0007186 G protein-coupled receptor signaling pathway; GO:0007218 neuropeptide signaling pathway; GO:0007268 chemical synaptic transmission; GO:0008343 adult feeding behavior; GO:0009267 cellular response to starvation; GO:0032099 negative regulation of appetite; GO:0032812 positive regulation of epinephrine secretion; GO:0032922 circadian regulation of gene expression; GO:0043410 positive regulation of MAPK cascade; GO:0045777 positive regulation of blood pressure; GO:0045860 positive regulation of protein kinase activity; GO:0051971 positive regulation of transmission of nerve impulse
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0045202 synapse

Sequence Information

  • Sequence:  YGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLK
  • Length:  39
  • Propeptide:  HEKELIEALQEVLKKLKSKRIPIYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLK
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Satiety factor closely associated with the actions of leptin and neuropeptide y; this anorectic peptide inhibits both normal and starvation-induced feeding and completely blocks the feeding response induced by neuropeptide Y and regulated by leptin in the hypothalamus. It promotes neuronal development and survival in vitro.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  7-25; 13-33
  • Structure ID:  AF-Q9BDP9-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor000707_AF2.pdbhor000707_ESM.pdb

Physical Information

Mass: 485490 Formula: C174H288N54O53S6
Absent amino acids: HW Common amino acids: CG
pI: 8.5 Basic residues: 6
Polar residues: 15 Hydrophobic residues: 10
Hydrophobicity: -20.77 Boman Index: -6327
Half-Life: 2.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: 2 min Aliphatic Index 62.56
Instability Index: 1548.21 Extinction Coefficient cystines: 1740
Absorbance 280nm: 45.79

Literature

  • PubMed ID:  NA
  • Title:  NA