General Information

  • ID:  hor000695
  • Uniprot ID:  Q68RJ9
  • Protein name:  Cocaine- and amphetamine-regulated transcript protein
  • Gene name:  CARTPT
  • Organism:  Bos taurus (Bovine)
  • Family:  CART family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Bos (genus), Bovinae (subfamily), Bovidae (family), Pecora (infraorder), Ruminantia (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005184 neuropeptide hormone activity
  • GO BP:  GO:0001678 intracellular glucose homeostasis; GO:0007186 G protein-coupled receptor signaling pathway; GO:0007218 neuropeptide signaling pathway; GO:0007268 chemical synaptic transmission; GO:0008343 adult feeding behavior; GO:0009267 cellular response to starvation; GO:0032099 negative regulation of appetite; GO:0032812 positive regulation of epinephrine secretion; GO:0032922 circadian regulation of gene expression; GO:0043410 positive regulation of MAPK cascade; GO:0045777 positive regulation of blood pressure; GO:0045779 negative regulation of bone resorption; GO:0045860 positive regulation of protein kinase activity; GO:0046850 regulation of bone remodeling; GO:0051971 positive regulation of transmission of nerve impulse
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0030141 secretory granule; GO:0045202 synapse

Sequence Information

  • Sequence:  QEDAELQPRALDIYSAVEDASHEKELIEALQEVLKKLKSKRIPIYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKCL
  • Length:  89
  • Propeptide:  MESPRLRLLPLLGAALLLLLPLLGALAQEDAELQPRALDIYSAVEDASHEKELIEALQEVLKKLKSKRIPIYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKCL
  • Signal peptide:  MESPRLRLLPLLGAALLLLLPLLGALA
  • Modification:  T14 Phosphotyrosine;T21 Phosphoserine
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Satiety factor closely associated with the actions of leptin and neuropeptide y; this anorectic peptide inhibits both normal and starvation-induced feeding and completely blocks the feeding response induced by neuropeptide Y and regulated by leptin in the hypothalamus. It promotes neuronal development and survival in vitro.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  55-73; 61-81; 75-88
  • Structure ID:  AF-Q68RJ9-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor000695_AF2.pdbhor000695_ESM.pdb

Physical Information

Mass: 1153946 Formula: C432H714N122O133S7
Absent amino acids: W Common amino acids: KLE
pI: 7.75 Basic residues: 16
Polar residues: 21 Hydrophobic residues: 28
Hydrophobicity: -45.28 Boman Index: -17183
Half-Life: 0.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 87.75
Instability Index: 3643.26 Extinction Coefficient cystines: 4845
Absorbance 280nm: 55.06

Literature

  • PubMed ID:  15670137
  • Title:  The Bovine Cocaine and Amphetamine-Regulated Transcript Locus: Gene Characterization and SNP Discovery