General Information

  • ID:  hor000684
  • Uniprot ID:  P10092
  • Protein name:  Calcitonin gene-related peptide 2
  • Gene name:  CALCB
  • Organism:  Homo sapiens (Human)
  • Family:  Calcitonin family
  • Source:  Human
  • Expression:  NA
  • Disease:  Diseases associated with CALCB include Immunodeficiency 17 and Thyroid Carcinoma, Familial Medullary.
  • Comments:  NA
  • Taxonomy:  Homo (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity; GO:0005515 protein binding; GO:0031716 calcitonin receptor binding
  • GO BP:  GO:0006874 intracellular calcium ion homeostasis; GO:0007165 signal transduction; GO:0007189 adenylate cyclase-activating G protein-coupled receptor signaling pathway; GO:0051480 regulation of cytosolic calcium ion concentration
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  ACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAF
  • Length:  37(82-118)
  • Propeptide:  MGFRKFSPFLALSILVLYQAGSLQAAPFRSALESSPDPATLSKEDARLLLAALVQDYVQMKASELKQEQETQGSSSAAQKRACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAFGRRRRDLQA
  • Signal peptide:  MGFRKFSPFLALSILVLYQAGSLQA
  • Modification:  T37 Phenylalanine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  CGRP induces vasodilation. It dilates a variety of vessels including the coronary, cerebral and systemic vasculature. Its abundance in the CNS also points toward a neurotransmitter or neuromodulator role.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  45695
  • Structure ID:  AF-P10092-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor000684_AF2.pdbhor000684_ESM.pdb

Physical Information

Mass: 443870 Formula: C162H268N50O49S3
Absent amino acids: DEIQWY Common amino acids: AGSTV
pI: 10.78 Basic residues: 5
Polar residues: 17 Hydrophobic residues: 13
Hydrophobicity: 22.16 Boman Index: -3661
Half-Life / Aliphatic Index: 4.4 hour Aliphatic Index: 73.78
Instability Index: 2940.27 Extinction Coefficient cystines: 125
Absorbance 280nm: 3.47

Literature

  • PubMed ID:  2322288
  • Title:  Isolation, Purification and Characterization of beta-hCGRP From Human Spinal Cord