General Information

  • ID:  hor000679
  • Uniprot ID:  Q766Y7
  • Protein name:  Calcitonin receptor-stimulating peptide 2
  • Gene name:  CRSP2
  • Organism:  Sus scrofa (Pig)
  • Family:  Calcitonin family
  • Source:  animal
  • Expression:  Mainly expressed in the thyroid gland and CNS. Found in the nerve cells of the cerebrum, hippocampus, hypothalamus, pons/midbrain and thalamus. Also detected in the glia-like cells of pons/midbrain and in meninx of tactus opticus.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Sus (genus), Suidae (family), Suina (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0031716 calcitonin receptor binding
  • GO BP:  GO:0007189 adenylate cyclase-activating G protein-coupled receptor signaling pathway; GO:0051480 regulation of cytosolic calcium ion concentration
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  SCNTASCVTHKMTGWLSRSGSVAKNNFMPTNVDSKILG
  • Length:  38
  • Propeptide:  MGFWKFPPFLVLSILVLYQAGMFHTAPVRLPLESSFDSATLTEEEVSLLLVAMVKDYVQMKATVLEQESEDFSITAQEKSCNTASCVTHKMTGWLSRSGSVAKNNFMPTNVDSKILG
  • Signal peptide:  MGFWKFPPFLVLSILVLYQAGMFHT
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  2-7
  • Structure ID:  AF-Q766Y7-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor000679_AF2.pdbhor000679_ESM.pdb

Physical Information

Mass: 470375 Formula: C170H277N51O55S4
Absent amino acids: EQY Common amino acids: S
pI: 9.67 Basic residues: 5
Polar residues: 19 Hydrophobic residues: 10
Hydrophobicity: -21.84 Boman Index: -5630
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 58.95
Instability Index: 6298.68 Extinction Coefficient cystines: 5625
Absorbance 280nm: 152.03

Literature

  • PubMed ID:  12914769
  • Title:  Identification of Second and Third Calcitonin Receptor-Stimulating Peptides in Porcine Brain.
  • PubMed ID:  18544925
  • Title:  Genomic Organization, Expression and Evolution of Porcine CRSP1, 2, and 3