General Information

  • ID:  hor000677
  • Uniprot ID:  B3IWF9
  • Protein name:  Calcitonin receptor-stimulating peptide 1
  • Gene name:  CRSP1
  • Organism:  Ovis aries (Sheep)
  • Family:  Calcitonin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Ovis (genus), Caprinae (subfamily), Bovidae (family), Pecora (infraorder), Ruminantia (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  ACNTATCMTHRLAGWLSRSGSMVRSNLLPTKMGFKIFSGPRRNFWF
  • Length:  46
  • Propeptide:  MGFWKFPPFLVLSILVLYQAGMFHAAPFRSVFDGRFDPATLDEEESRLLLAAMVNDYEQMRTRESEKAQKTEGSRIQKRACNTATCMTHRLAGWLSRSGSMVRSNLLPTKMGFKIFSGPRRNFWF
  • Signal peptide:  MGFWKFPPFLVLSILVLYQAGMFHA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Stimulates cAMP production via the calcitonin receptor (CT) but not via the CT-like (CL) receptor.
  • Mechanism:  Stimulates cAMP production via the calcitonin receptor (CT) but not via the CT-like (CL) receptor.
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  2-7
  • Structure ID:  AF-B3IWF9-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor000677_AF2.pdbhor000677_ESM.pdb

Physical Information

Mass: 603897 Formula: C232H362N70O59S5
Absent amino acids: DEQY Common amino acids: RS
pI: 12.34 Basic residues: 8
Polar residues: 18 Hydrophobic residues: 15
Hydrophobicity: -13.48 Boman Index: -7354
Half-Life: 4.4 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 55.22
Instability Index: 6899.57 Extinction Coefficient cystines: 11125
Absorbance 280nm: 247.22

Literature

  • PubMed ID:  NA
  • Title:  Identification and biological activity of ovine and caprine calcitonin receptor-Sti.