General Information

  • ID:  hor000673
  • Uniprot ID:  Q9N0T3
  • Protein name:  Calcitonin gene-related peptide 2
  • Gene name:  CALCB
  • Organism:  Equus caballus (Horse)
  • Family:  Calcitonin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Equus (genus), Equidae (family), Perissodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0031716 calcitonin receptor binding
  • GO BP:  GO:0007165 signal transduction; GO:0007189 adenylate cyclase-activating G protein-coupled receptor signaling pathway; GO:0051480 regulation of cytosolic calcium ion concentration
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  SCNTATCVTHRLAGLLSRSGGVVKSNFVPTDVGSEAF
  • Length:  37(84-120)
  • Propeptide:  MGFGKPSSFLAFSILVLCQAGSLQAQPLRSSLESLPDPAALSEKEGRLLLAALVKAYVQRKTNELEQEQEQEMEGSSLTAQKRSCNTATCVTHRLAGLLSRSGGVVKSNFVPTDVGSEAFGRRRRDLQA
  • Signal peptide:  MGFGKPSSFLAFSILVLCQAGSLQA
  • Modification:  T37 Phenylalanine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  CGRP induces vasodilation. It dilates a variety of vessels including the coronary, cerebral and systemic vasculature. Its abundance in the CNS also points toward a neurotransmitter or neuromodulator role
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  CALCR, CALCRL
  • Target Unid:   F6YHG4, F7BDX2
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  45695
  • Structure ID:  AF-Q9N0T3-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor000673_AF2.pdbhor000673_ESM.pdb

Physical Information

Mass: 442456 Formula: C161H262N48O53S2
Absent amino acids: IMQWY Common amino acids: SV
pI: 8.24 Basic residues: 4
Polar residues: 17 Hydrophobic residues: 13
Hydrophobicity: 22.43 Boman Index: -4347
Half-Life / Aliphatic Index: 1.9 hour Aliphatic Index: 78.92
Instability Index: 3560.54 Extinction Coefficient cystines: 125
Absorbance 280nm: 3.47

Literature

  • PubMed ID:  12581884
  • Title:  Molecular Cloning and Expression of Equine Calcitonin, Calcitonin Gene-Related peptide-I, and Calcitonin Gene-Related peptide-II