General Information

  • ID:  hor000669
  • Uniprot ID:  Q75V93
  • Protein name:  Calcitonin receptor-stimulating peptide 2
  • Gene name:  CRSP2
  • Organism:  Canis lupus familiaris (Dog) (Canis familiaris)
  • Family:  Calcitonin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Canis lupus (species), Canis (genus), Canidae (family), Caniformia (suborder), Carnivora (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0031716 calcitonin receptor binding
  • GO BP:  GO:0007189 adenylate cyclase-activating G protein-coupled receptor signaling pathway; GO:0051480 regulation of cytosolic calcium ion concentration
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  SCKDGPCVTNRLEGWLARAERMVKNTFMPTDVDPEAFGHQHKELAA
  • Length:  46
  • Propeptide:  MGFWKLSPFLAIGLLVMYQAGILQAAPFRSALENPLESATLTEDEICVLLTAVVKDYVQMKARELQQEQETEGSSLTAQKSSCKDGPCVTNRLEGWLARAERMVKNTFMPTDVDPEAFGHQHKELAA
  • Signal peptide:  MGFWKLSPFLAIGLLVMYQAGILQA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  2-7
  • Structure ID:  AF-Q75V93-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor000669_AF2.pdbhor000669_ESM.pdb

Physical Information

Mass: 596070 Formula: C222H348N66O68S4
Absent amino acids: IY Common amino acids: A
pI: 6.5 Basic residues: 8
Polar residues: 11 Hydrophobic residues: 14
Hydrophobicity: -63.04 Boman Index: -9976
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 55.22
Instability Index: 2926.52 Extinction Coefficient cystines: 5625
Absorbance 280nm: 125

Literature

  • PubMed ID:  14672700
  • Title:  Identification, Structural Determination, and Biological Activity of Bovine and Canine Calcitonin Receptor-Stimulating Peptides