General Information

  • ID:  hor000668
  • Uniprot ID:  Q75V94
  • Protein name:  Calcitonin receptor-stimulating peptide 1
  • Gene name:  CRSP1
  • Organism:  Canis lupus familiaris (Dog) (Canis familiaris)
  • Family:  Calcitonin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Canis lupus (species), Canis (genus), Canidae (family), Caniformia (suborder), Carnivora (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0031716 calcitonin receptor binding
  • GO BP:  GO:0007165 signal transduction; GO:0007189 adenylate cyclase-activating G protein-coupled receptor signaling pathway; GO:0051480 regulation of cytosolic calcium ion concentration
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  SCNSATCVAHWLGGLLSRAGSVANTNLLPTSMGFKVYNRRRRELKA
  • Length:  46
  • Propeptide:  MGFWKFSPFLVLGILALYQVGFLQAAPFRSALENPPDSGVRNEEELRLLLAAVMKDYMQMKTHELEQEQETEGSRVAVQKRSCNSATCVAHWLGGLLSRAGSVANTNLLPTSMGFKVYNRRRRELKA
  • Signal peptide:  MGFWKFSPFLVLGILALYQVGFLQA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Stimulates cAMP production in porcine kidney cell line LLC-PK1 via the calcitonin receptor (CT) but not via the CT-like (CL) receptor.
  • Mechanism:  Stimulates cAMP production in porcine kidney cell line LLC-PK1 via the calcitonin receptor (CT) but not via the CT-like (CL) receptor
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  2-7
  • Structure ID:  AF-Q75V94-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor000668_AF2.pdbhor000668_ESM.pdb

Physical Information

Mass: 581062 Formula: C215H354N70O62S3
Absent amino acids: DIQ Common amino acids: L
pI: 11.45 Basic residues: 8
Polar residues: 19 Hydrophobic residues: 16
Hydrophobicity: -18.26 Boman Index: -8391
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 80.65
Instability Index: 4994.78 Extinction Coefficient cystines: 7115
Absorbance 280nm: 158.11

Literature

  • PubMed ID:  14672700
  • Title:  Identification, Structural Determination, and Biological Activity of Bovine and Canine Calcitonin Receptor-Stimulating Peptides