General Information

  • ID:  hor000667
  • Uniprot ID:  P41547
  • Protein name:  Calcitonin
  • Gene name:  CALCA
  • Organism:  Canis lupus familiaris (Dog) (Canis familiaris)
  • Family:  Calcitonin family
  • Source:  animal
  • Expression:  Synthesized by C-cells of the thyroid gland.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Canis lupus (species), Canis (genus), Canidae (family), Caniformia (suborder), Carnivora (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  CSNLSTCVLGTYSKDLNNFHTFSGIGFGAETP
  • Length:  32
  • Propeptide:  MGLWKSSPFLAFSILVLCQAGGLQAAPFRSALEGLPDPTALSEKEGRLLLAALVKAYVQRKNELEQEQEQETEGSSLDSSRAKRCSNLSTCVLGTYSKDLNNFHTFSGIGFGAETPGKKRDIASGLERGR
  • Signal peptide:  MGLWKSSPFLAFSILVLCQAGGLQA
  • Modification:  T32 Proline amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Causes a rapid but short-lived drop in the level of calcium and phosphate in blood by promoting the incorporation of those ions in the bones.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  1-7
  • Structure ID:  AF-P41547-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor000667_AF2.pdbhor000667_ESM.pdb

Physical Information

Mass: 393485 Formula: C148H222N38O49S2
Absent amino acids: MQRW Common amino acids: GST
pI: 5.45 Basic residues: 2
Polar residues: 18 Hydrophobic residues: 9
Hydrophobicity: 0.63 Boman Index: -2889
Half-Life: 1.2 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 60.94
Instability Index: -382.5 Extinction Coefficient cystines: 1615
Absorbance 280nm: 52.1

Literature

  • PubMed ID:  10967131
  • Title:  Molecular Analysis and Chromosomal Assignment of the Canine CALC-I/alpha-CGRP Gene