General Information

  • ID:  hor000664
  • Uniprot ID:  P81564
  • Protein name:  Calcitonin gene-related peptide
  • Gene name:  NA
  • Organism:  Phyllomedusa bicolor (Two-colored leaf frog) (Rana bicolor)
  • Family:  Calcitonin family
  • Source:  animal
  • Expression:  Skin, intestine and brain.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Phyllomedusa (genus), Phyllomedusinae (subfamily), Hylidae (family), Hyloidea (superfamily), Neobatrachia (suborder), Anura (order), Batrachia (superorder), Amphibia (class), Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  SCDTSTCATQRLADFLSRSGGIGSPDFVPTDVSANSF
  • Length:  37
  • Propeptide:  MVLLKISSLLAVLGLLVCQMYSSQAAPARRALEPLPDRVTEAHRLLRALIRELTAEDMEASSSGAAHKRSCDTSTCATQRLADFLSRSGGIGSPDFVPTDVSANSFGRRRRSLHV
  • Signal peptide:  MVLLKISSLLAVLGLLVCQMYSSQA
  • Modification:  T37 Phenylalanine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  CGRP induces vasodilation. It dilates a variety of vessels including the coronary, cerebral and systemic vasculature. Its abundance in the CNS also points toward a neurotransmitter or neuromodulator role
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  2-7
  • Structure ID:  AF-P81564-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor000664_AF2.pdbhor000664_ESM.pdb

Physical Information

Mass: 445342 Formula: C160H249N45O59S2
Absent amino acids: EHKMWY Common amino acids: S
pI: 4.02 Basic residues: 2
Polar residues: 17 Hydrophobic residues: 11
Hydrophobicity: -9.46 Boman Index: -6839
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 55.41
Instability Index: 4419.73 Extinction Coefficient cystines: 125
Absorbance 280nm: 3.47

Literature

  • PubMed ID:  10681586
  • Title:  Isolation, Structure, Synthesis, and Activity of a New Member of the Calcitonin Gene-Related Peptide Family From Frog Skin and Molecular Cloning of Its Precursor