General Information

  • ID:  hor000663
  • Uniprot ID:  NA
  • Protein name:  Calcitonin gene-related peptide
  • Gene name:  NA
  • Organism:  Pelophylax ridibundus
  • Family:  Calcitonin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  NA
  • GO MF:  NA
  • GO BP:  NA
  • GO CC:  NA

Sequence Information

  • Sequence:  ACNTATCVTHRLADFLSRSGGMAKNNFVPTNVGSAF
  • Length:  36
  • Propeptide:  NA
  • Signal peptide:  NA
  • Modification:  T36 Phenylalanine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Act in a coordinated manner in sensory neurotransmission
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor000663_AF2.pdbhor000663_ESM.pdb

Physical Information

Mass: 438372 Formula: C160H253N49O50S3
Absent amino acids: EIQWY Common amino acids: A
pI: 8.83 Basic residues: 4
Polar residues: 16 Hydrophobic residues: 13
Hydrophobicity: 8.06 Boman Index: -4813
Half-Life / Aliphatic Index: 4.4 hour Aliphatic Index: 59.72
Instability Index: 2971.67 Extinction Coefficient cystines: 125
Absorbance 280nm: 3.57

Literature

  • PubMed ID:  8332553
  • Title:  Isolation and Structural Characterization of Calcitonin Gene-Related Peptide From the Brain and Intestine of the Frog, Rana Ridibunda