General Information

  • ID:  hor000662
  • Uniprot ID:  NA
  • Protein name:  Calcitonin gene-related peptide
  • Gene name:  NA
  • Organism:  NA
  • Family:  Calcitonin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  NA
  • GO MF:  NA
  • GO BP:  NA
  • GO CC:  NA

Sequence Information

  • Sequence:  SCNTATCVTHRLAGLLSRLGGVVKSNFVPTNVGSQAF
  • Length:  37
  • Propeptide:  NA
  • Signal peptide:  NA
  • Modification:  T37 Phenylalanine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Have adenylate cyclase stimulating activity
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor000662_AF2.pdbhor000662_ESM.pdb

Physical Information

Mass: 444868 Formula: C164H270N50O50S2
Absent amino acids: DEIMWY Common amino acids: V
pI: 9.92 Basic residues: 4
Polar residues: 17 Hydrophobic residues: 14
Hydrophobicity: 34.86 Boman Index: -3180
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 89.46
Instability Index: 1966.76 Extinction Coefficient cystines: 125
Absorbance 280nm: 3.47

Literature

  • PubMed ID:  1417824
  • Title:  Identification of Calcitonin Gene Related Peptide in Ovine Hypothalamic Extract