General Information

  • ID:  hor000655
  • Uniprot ID:  P85798
  • Protein name:  LRNQLDIGDLQ鈥揳llatostatinC
  • Gene name:  NA
  • Organism:  Apis mellifera (Honeybee)
  • Family:  Allatostatin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Apis (genus), Apini (tribe), Apinae (subfamily), Apidae (family), Apoidea (superfamily), Aculeata (infraorder), Apocrita (suborder), Hymenoptera (order), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  NA
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  LRNQLDIGDL
  • Length:  10(62-71)
  • Propeptide:  MSSLRIAMFLLVVLMVLIDCSTAIPAADKERLLNEVDLVDDDGSIETALINYLFTKQIVKRLRNQLDIGDLQRKRSYWKQCAFNAVSCFGK
  • Signal peptide:  MSSLRIAMFLLVVLMVLIDCSTA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P85798-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor000655_AF2.pdbhor000655_ESM.pdb

Physical Information

Mass: 131704 Formula: C49H85N15O17
Absent amino acids: ACEFHKMPSTVWY Common amino acids: L
pI: 4.11 Basic residues: 1
Polar residues: 2 Hydrophobic residues: 4
Hydrophobicity: -30 Boman Index: -2392
Half-Life: 5.5 hour Half-Life Yeast: 3 min
Half-Life E.Coli: 2 min Aliphatic Index 156
Instability Index: 3306 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  17068263
  • Title:  From the Genome to the Proteome: Uncovering Peptides in the Apis Brain