General Information

  • ID:  hor000640
  • Uniprot ID:  O44314
  • Protein name:  Helicostatin-1
  • Gene name:  NA
  • Organism:  Helicoverpa armigera (Cotton bollworm) (Heliothis armigera)
  • Family:  Allatostatin family
  • Source:  animal
  • Expression:  Highly expressed in the CNS and gut of larvae. Also expressed in the cells of the larval brain and ventral nerve cord and in endocrine cells of the midgut.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Helicoverpa (genus), Heliothinae (subfamily), Noctuidae (family), Noctuoidea (superfamily), Obtectomera, Ditrysia, Heteroneura (parvorder), Neolepidoptera (infraorder), Glossata (suborder), Lepidoptera (order), Amphiesmenoptera (superorder), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005184 neuropeptide hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  SPHYDFGL
  • Length:  8(51-58)
  • Propeptide:  MLYSSLPVCFLVLGAALCAPERMQNEAEPHDLQPHEAEPHSDHVAPLAKRSPHYDFGLGKRAYSYVSEYKRLPVYNFGLGKRSRPYSFGLGKRSVDEDQSNDEQQLTTSDLDQAALAELFDQYDDAEKRARPYSFGLGKRFADDETSEEKRARAYDFGLGKRLPMYNFGLGKRARSYNFGLGKRYSKFNFGLGKRERDMHRFSFGLGKRSGDDVSADDSDNYFDV
  • Signal peptide:  MLYSSLPVCFLVLGAALC
  • Modification:  T8 Leucine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  May act as a neurotransmitter or neuromodulator.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-O44314-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor000640_AF2.pdbhor000640_ESM.pdb

Physical Information

Mass: 106004 Formula: C44H58N10O13
Absent amino acids: ACEIKMNQRTVW Common amino acids: DFGHLPSY
pI: 5.29 Basic residues: 1
Polar residues: 3 Hydrophobic residues: 2
Hydrophobicity: -52.5 Boman Index: -808
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 48.75
Instability Index: 13877.5 Extinction Coefficient cystines: 1490
Absorbance 280nm: 212.86

Literature

  • PubMed ID:  9392829
  • Title:  Lepidopteran Peptides of the Allatostatin Superfamily