General Information

  • ID:  hor000635
  • Uniprot ID:  Q9VC44
  • Protein name:  Drostatin-5
  • Gene name:  AstA
  • Organism:  Drosophila melanogaster (Fruit fly)
  • Family:  Allatostatin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  melanogaster subgroup, melanogaster group, Sophophora (subgenus), Drosophila (genus), Drosophilini (tribe), Drosophilinae (subfamily), Drosophilidae (family), Ephydroidea (superfamily), Acalyptratae, Schizophora, Cyclorrhapha, Eremoneura, Muscomorpha (infraorder), Brachycera (suborder), Diptera (order), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005102 signaling receptor binding; GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity; GO:0071855 neuropeptide receptor binding
  • GO BP:  GO:0007218 neuropeptide signaling pathway; GO:0045968 negative regulation of juvenile hormone biosynthetic process
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  AYMYTNGGPGM
  • Length:  11(68-78)
  • Propeptide:  MNSLHAHLLLLAVCCVGYIASSPVIGQDQRSGDSDADVLLAADEMADNGGDNIDKRVERYAFGLGRRAYMYTNGGPGMKRLPVYNFGLGKRSRPYSFGLGKRSDYDYDQDNEIDYRVPPANYLAAERAVRPGRQNKRTTRPQPFNFGLGRR
  • Signal peptide:  MNSLHAHLLLLAVCCVGYIAS
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  May act as a neurotransmitter or neuromodulator
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  AstA-R2
  • Target Unid:   Q9NBC8
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q9VC44-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor000635_AF2.pdbhor000635_ESM.pdb

Physical Information

Mass: 133986 Formula: C50H72N12O16S2
Absent amino acids: CDEFHIKLQRSVW Common amino acids: G
pI: 6.09 Basic residues: 0
Polar residues: 7 Hydrophobic residues: 1
Hydrophobicity: -36.36 Boman Index: -16
Half-Life / Aliphatic Index: 4.4 hour Aliphatic Index: 9.09
Instability Index: 4673.64 Extinction Coefficient cystines: 2980
Absorbance 280nm: 298

Literature

  • PubMed ID:  12171930
  • Title:  Peptidomics and peptide hormone processing in the Drosophila midgut.