General Information

  • ID:  hor000623
  • Uniprot ID:  P12764
  • Protein name:  Allatostatin-2
  • Gene name:  NA
  • Organism:  Diploptera punctata (Pacific beetle cockroach)
  • Family:  Allatostatin family
  • Source:  animal
  • Expression:  Brain, subesophageal ganglion and corpus allatum.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Diploptera (genus), Diplopterinae (subfamily), Blaberidae (family), Blaberoidea (superfamily), Blattodea (order), Dictyoptera (superorder), Polyneoptera (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005184 neuropeptide hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  AYSYVSEYKRLPVYNFGL
  • Length:  18(77-94)
  • Propeptide:  MSGPRTCFCLPSALVLVLLSLSTSALGTAPEPSGVHEESPAGGGTDLLPHPEDLSASDNPDLEFVKRLYDFGLGKRAYSYVSEYKRLPVYNFGLGKRSKMYGFGLGKRDGRMYSFGLGKRDYDYYGEEDEDDQQAIGDEDIEESDVGDLMDKRDRLYSFGLGKRARPYSFGLGKRAPSGAQRLYGFGLGKRGGSLYSFGLGKRGDGRLYAFGLGKRPVNSGRSSGSRFNFGLGKRSDDIDFRELEEKFAEDKRYP
  • Signal peptide:  MSGPRTCFCLPSALVLVLLSLSTSALG
  • Modification:  T18 Leucine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Neuropeptide inhibitors of juvenile hormone synthesis and gut muscle contraction.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P12764-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor000623_AF2.pdbhor000623_ESM.pdb

Physical Information

Mass: 247285 Formula: C104H149N23O28
Absent amino acids: CDHIMQTW Common amino acids: Y
pI: 8.98 Basic residues: 2
Polar residues: 8 Hydrophobic residues: 6
Hydrophobicity: -20 Boman Index: -1763
Half-Life: 4.4 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 81.11
Instability Index: 4711.67 Extinction Coefficient cystines: 5960
Absorbance 280nm: 350.59

Literature

  • PubMed ID:  2006179
  • Title:  Identity of a second type of allatostatin from cockroach brains: an octadecapeptide amide with a tyrosine-rich address sequence.