General Information

  • ID:  hor000579
  • Uniprot ID:  P85797
  • Protein name:  Allatostatin-3
  • Gene name:  NA
  • Organism:  Apis mellifera (Honeybee)
  • Family:  Allatostatin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Apis (genus), Apini (tribe), Apinae (subfamily), Apidae (family), Apoidea (superfamily), Aculeata (infraorder), Apocrita (suborder), Hymenoptera (order), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  GRDYSFGL
  • Length:  8(89-96)
  • Propeptide:  MRSRTSVLTSSLAFLYFFGIVGRSALAMEETPASSMNLQHYNNMLNPMVFDDTMPEKRAYTYVSEYKRLPVYNFGIGKRWIDTNDNKRGRDYSFGLGKRRQYSFGLGKRNDNADYPLRLNLDYLPVDNPAFHSQENTDDFLEEKRGRQPYSFGLGKRAVHYSGGQPLGSKRPNDMLSQRYHFGLGKRMSEDEEESSQ
  • Signal peptide:  MRSRTSVLTSSLAFLYFFGIVGRSALA
  • Modification:  T8 Leucine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Neuropeptides.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P85797-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor000579_AF2.pdbhor000579_ESM.pdb

Physical Information

Mass: 103902 Formula: C41H59N11O13
Absent amino acids: ACEHIKMNPQTVW Common amino acids: G
pI: 6.34 Basic residues: 1
Polar residues: 4 Hydrophobic residues: 2
Hydrophobicity: -53.75 Boman Index: -1740
Half-Life / Aliphatic Index: 30 hour Aliphatic Index: 48.75
Instability Index: 875 Extinction Coefficient cystines: 1490
Absorbance 280nm: 212.86

Literature

  • PubMed ID:  17068263
  • Title:  From the Genome to the Proteome: Uncovering Peptides in the Apis Brain