General Information

  • ID:  hor000577
  • Uniprot ID:  P85797
  • Protein name:  Allatostatin-2a
  • Gene name:  NA
  • Organism:  Apis mellifera (Honeybee)
  • Family:  Allatostatin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Apis (genus), Apini (tribe), Apinae (subfamily), Apidae (family), Apoidea (superfamily), Aculeata (infraorder), Apocrita (suborder), Hymenoptera (order), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  LPVYNFGI
  • Length:  8(69-76)
  • Propeptide:  MRSRTSVLTSSLAFLYFFGIVGRSALAMEETPASSMNLQHYNNMLNPMVFDDTMPEKRAYTYVSEYKRLPVYNFGIGKRWIDTNDNKRGRDYSFGLGKRRQYSFGLGKRNDNADYPLRLNLDYLPVDNPAFHSQENTDDFLEEKRGRQPYSFGLGKRAVHYSGGQPLGSKRPNDMLSQRYHFGLGKRMSEDEEESSQ
  • Signal peptide:  MRSRTSVLTSSLAFLYFFGIVGRSALA
  • Modification:  T8 Isoleucine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Neuropeptides.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P85797-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor000577_AF2.pdbhor000577_ESM.pdb

Physical Information

Mass: 104713 Formula: C46H67N9O11
Absent amino acids: ACDEHKMQRSTW Common amino acids: FGILNPVY
pI: 6.09 Basic residues: 0
Polar residues: 3 Hydrophobic residues: 4
Hydrophobicity: 106.25 Boman Index: 1102
Half-Life: 5.5 hour Half-Life Yeast: 3 min
Half-Life E.Coli: 2 min Aliphatic Index 133.75
Instability Index: 1807.5 Extinction Coefficient cystines: 1490
Absorbance 280nm: 212.86

Literature

  • PubMed ID:  17068263
  • Title:  From the Genome to the Proteome: Uncovering Peptides in the Apis Brain