General Information

  • ID:  hor000575
  • Uniprot ID:  A0A977XCS9
  • Protein name:  Trica-MIP-4
  • Gene name:  NA
  • Organism:  Zophobas atratus (Giant mealworm beetle) (Zophobas rugipes)
  • Family:  Allatostatin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Zophobas (genus), Tenebrioninae (subfamily), Tenebrionidae (family), Tenebrionoidea (superfamily), Cucujiformia (infraorder), Polyphaga (suborder), Coleoptera (order), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  NA
  • GO CC:  NA

Sequence Information

  • Sequence:  NWGQFHGGW
  • Length:  9(140-148)
  • Propeptide:  MRDAAVAVSARFLGAVLFVCCLQASLTVALSDETPMKSSNDNPQMDYDMSKRDWNKDLHIWGKRGWNNLHDGWGRKRSVPSWADQADKRAWQNLHSGWGKRFTPEDEDTLRQLVAMIDRVDPQYDEYDNDLEANDDDKRNWGQFHGGWGKRSNWGNFRGSWGKREPAWSNLKGIWGKRSQDQIAQ
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor000575_AF2.pdbhor000575_ESM.pdb

Physical Information

Mass: 123103 Formula: C52H61N15O12
Absent amino acids: ACDEIKLMPRSTVY Common amino acids: G
pI: 7.55 Basic residues: 1
Polar residues: 4 Hydrophobic residues: 3
Hydrophobicity: -115.56 Boman Index: -638
Half-Life: 1.4 hour Half-Life Yeast: 3 min
Half-Life E.Coli: >10 hour Aliphatic Index 0
Instability Index: -663.33 Extinction Coefficient cystines: 11000
Absorbance 280nm: 1375

Literature

  • PubMed ID:  21067424
  • Title:  Identification of Myotropic Neuropeptides From the Brain and Corpus Cardiacum-Corpus Allatum Complex of the Beetle, Zophobas Atratus