General Information

  • ID:  hor000533
  • Uniprot ID:  A0A921Z0J2
  • Protein name:  Mas-MIP II
  • Gene name:  NA
  • Organism:  Manduca sexta (Tobacco hawkmoth) (Tobacco hornworm)
  • Family:  Allatostatin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Manduca (genus), Sphingini (tribe), Sphinginae (subfamily), Sphingidae (family), Bombycoidea (superfamily), Obtectomera, Ditrysia, Heteroneura (parvorder), Neolepidoptera (infraorder), Glossata (suborder), Lepidoptera (order), Amphiesmenoptera (superorder), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  NA
  • GO CC:  NA

Sequence Information

  • Sequence:  GWQDLNSAW
  • Length:  9(104-112)
  • Propeptide:  MRCCVAVLWAFFATWAVAAAEEPHHDAAPQTDNELDLTDEDKRAWTSLRGGWAKRGWQDMSSAWGKRAWQDLNSAWGKRAWQDLNSAWGKRAWQDLNSAWGKRGWQDLNSAWGKRSDDEAMDKRAWQDLNSAWGKRGWQDMSSAWGKRAWQDLNSAWGKRGWNDMSSAWGKRAWQDLNSAWGKRGWQDMSSAWGKRAPEKWAAFHGSWGKRAAEPDYEELDAAIEQLVPIHQMDEDRMDAPEKKAWSALHGAWGK
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Metamorphosis and muscle contractions
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor000533_AF2.pdbhor000533_ESM.pdb

Physical Information

Mass: 121902 Formula: C49H65N13O15
Absent amino acids: CEFHIKMPRTVY Common amino acids: W
pI: 3.75 Basic residues: 0
Polar residues: 3 Hydrophobic residues: 4
Hydrophobicity: -87.78 Boman Index: -1197
Half-Life / Aliphatic Index: 30 hour Aliphatic Index: 54.44
Instability Index: 4300 Extinction Coefficient cystines: 11000
Absorbance 280nm: 1375

Literature

  • PubMed ID:  16061202
  • Title:  Discovering Neuropeptides in Caenorhabditis Elegans by Two Dimensional Liquid Chromatography and Mass Spectrometry