General Information

  • ID:  hor000528
  • Uniprot ID:  A0A921ZJJ1
  • Protein name:  Helicostatin-1
  • Gene name:  NA
  • Organism:  Manduca sexta (Tobacco hawkmoth) (Tobacco hornworm)
  • Family:  Allatostatin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Manduca (genus), Sphingini (tribe), Sphinginae (subfamily), Sphingidae (family), Bombycoidea (superfamily), Obtectomera, Ditrysia, Heteroneura (parvorder), Neolepidoptera (infraorder), Glossata (suborder), Lepidoptera (order), Amphiesmenoptera (superorder), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005184 neuropeptide hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  NA

Sequence Information

  • Sequence:  SPHYDFGL
  • Length:  8(44-51)
  • Propeptide:  MLSLLVPLWVVASALSVLSGALGEPERSGPVAAPAPPAALEKRSPHYDFGLGKRAYSYVPSVLVRPRQALGGGGSARGGYEVKRARPYSFGLGKRLAEDETSEEKRARMYDFGLGKRLPMYNFGLGKRAKSYNFGLGKRLSSKFNFGLGKRERDMNRFRFGLGKRSEGELPAAPAAAPADTDNYFDI
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor000528_AF2.pdbhor000528_ESM.pdb

Physical Information

Mass: 106004 Formula: C44H58N10O13
Absent amino acids: ACEIKMNQRTVW Common amino acids: DFGHLPSY
pI: 5.29 Basic residues: 1
Polar residues: 3 Hydrophobic residues: 2
Hydrophobicity: -52.5 Boman Index: -808
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 48.75
Instability Index: 13877.5 Extinction Coefficient cystines: 1490
Absorbance 280nm: 212.86

Literature

  • PubMed ID:  14599724
  • Title:  A Comparison of the Neuropeptides From the Retrocerebral Complex of Adult Male and Female Manduca Sexta Using MALDI-TOF Mass Spectrometry