General Information

  • ID:  hor000425
  • Uniprot ID:  A0A6G4ZU61
  • Protein name:  Cam-AST-B4
  • Gene name:  NA
  • Organism:  Carausius morosus (Indian stick insect) (Dixippus morosus)
  • Family:  Allatostatin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Carausius (genus), Lonchodinae (subfamily), Lonchodidae (family), Anareolatae (infraorder), Verophasmatodea (suborder), Phasmatodea (order), Polyneoptera (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  NA
  • GO CC:  NA

Sequence Information

  • Sequence:  AWQDLQGAW
  • Length:  9(53-61)
  • Propeptide:  MATSVGLLGLMLLVSIAPCSLGDAVPEAGRPQQLGDVQPARPQPPTTDEDKRAWQDLQGAWGKRGWQDLQAGWGKRAWQDLGSAWGKRAWQDLNTGWGKRGWQDLQSGWGKRAWQDLQGGWGKRAWDDLRPMWGKRYLYPEPSDDETAEDDALPVAAVSLAEDEDDQASDDKRAWRALGGAWGKRSADWANFRGMKEEPGASSSEE
  • Signal peptide:  MATSVGLLGLMLLVSIAPCSLG
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Metamorphosis and muscle contractions
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-A0A6G4ZU61-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor000425_AF2.pdbhor000425_ESM.pdb

Physical Information

Mass: 121706 Formula: C50H67N13O14
Absent amino acids: CEFHIKMNPRSTVY Common amino acids: AQW
pI: 3.75 Basic residues: 0
Polar residues: 1 Hydrophobic residues: 5
Hydrophobicity: -58.89 Boman Index: -566
Half-Life: 4.4 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 65.56
Instability Index: 5707.78 Extinction Coefficient cystines: 11000
Absorbance 280nm: 1375

Literature

  • PubMed ID:  16061202
  • Title:  Discovering Neuropeptides in Caenorhabditis Elegans by Two Dimensional Liquid Chromatography and Mass Spectrometry