General Information

  • ID:  hor000347
  • Uniprot ID:  Q1DH34
  • Protein name:  Allatostatin-5
  • Gene name:  NA
  • Organism:  Aedes aegypti (Yellowfever mosquito) (Culex aegypti)
  • Family:  Allatostatin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Stegomyia (subgenus), Aedes (genus), Aedini (tribe), Culicinae (subfamily), Culicidae (family), Culicoidea (superfamily), Culicomorpha (infraorder), Nematocera (suborder), Diptera (order), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005184 neuropeptide hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  NA

Sequence Information

  • Sequence:  LPNRYNFGL
  • Length:  9(186-194)
  • Propeptide:  MRPSTTPMVLLSYLAFVLCLACVAYGSSALGSSSGTSDQSLFGGGAGGGGGSASAESDIGDDRGQQEISQATFQHMLAVRSPKYNFGLGKRRYIIEDVPGAKRLPHYNFGLGKRARNNLLEYDDDSAPSWSEDYSSLIPRDGLDYDGDKDKSAEKRASAYRYHFGLGKRRVYDFGLGKRVYEDKRLPNRYNFGLGRR
  • Signal peptide:  MRPSTTPMVLLSYLAFVLCLACVAYGSSA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q1DH34-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor000347_AF2.pdbhor000347_ESM.pdb

Physical Information

Mass: 123612 Formula: C51H76N14O13
Absent amino acids: ACDEHIKMQSTVW Common amino acids: LN
pI: 9.35 Basic residues: 1
Polar residues: 4 Hydrophobic residues: 3
Hydrophobicity: -48.89 Boman Index: -1458
Half-Life: 5.5 hour Half-Life Yeast: 3 min
Half-Life E.Coli: 2 min Aliphatic Index 86.67
Instability Index: 521.11 Extinction Coefficient cystines: 1490
Absorbance 280nm: 186.25

Literature

  • PubMed ID:  20163154
  • Title:  Neuropeptidomics of the Mosquito Aedes Aegypti