General Information

  • ID:  hor000307
  • Uniprot ID:  A0A2P8YBG2
  • Protein name:  BLAST-4
  • Gene name:  ALLS
  • Organism:  Blattella germanica (German cockroach) (Blatta germanica)
  • Family:  Allatostatin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Blattella (genus), Blattellinae (subfamily), Ectobiidae (family), Blaberoidea (superfamily), Blattodea (order), Dictyoptera (superorder), Polyneoptera (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  NA
  • GO CC:  NA

Sequence Information

  • Sequence:  APSSAQRLYGFGL
  • Length:  13
  • Propeptide:  MLIATFFNEKPMPGPRTCYSLQAALVLSLLLKLSSSAFATTTSAGTHAVQEESSAGGGAEILPRLEELADNSELDLVKRLYDFGLGKRAYSYVSEYKRLPVYNFGLGKRSKMYGFGLGKRAGSDGRLYSFGLGKRDYDDYYGDDDEEDHQTSADEDIEDADSVDLMDKRDRLYSFGLGKRARPYSFGLGKRAPSSAQRLYGFGLGKRALYSFGLGKRAGGRLYSFGLGKRPVNSGRQSGSRFNFGLGKRSDDFDI
  • Signal peptide:  MLIATFFNEKPMPGPRTCYSLQAALVLSLLLKLSSSAFA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Inhibited in vitro juvenile hormone production by corpora allata from virgin females of B. germanica.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-A0A2P8YBG2-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor000307_AF2.pdbhor000307_ESM.pdb

Physical Information

Mass: 158076 Formula: C62H95N17O18
Absent amino acids: CDEHIKMNTVW Common amino acids: AGLS
pI: 9.35 Basic residues: 1
Polar residues: 5 Hydrophobic residues: 5
Hydrophobicity: 5.38 Boman Index: -908
Half-Life / Aliphatic Index: 4.4 hour Aliphatic Index: 75.38
Instability Index: 4714.62 Extinction Coefficient cystines: 1490
Absorbance 280nm: 124.17

Literature

  • PubMed ID:  7846299
  • Title:  Allatostatic Neuropeptides From the Cockroach Blattella Germanica (L.) (Dictyoptera, Blattellidae). Identification, Immunolocalization and Activity