General Information

  • ID:  hor000301
  • Uniprot ID:  F0J9E4
  • Protein name:  Allatostatin CC peptide
  • Gene name:  NA
  • Organism:  Amblyomma variegatum (Tropical bont tick)
  • Family:  Allatostatin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Amblyomma (genus), Amblyomminae (subfamily), Ixodidae (family), Ixodoidea (superfamily), Ixodida (order), Parasitiformes (superorder), Acari (subclass), Arachnida (class), Chelicerata (subphylum), Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  NA
  • GO CC:  NA

Sequence Information

  • Sequence:  GEGKMFWRCYFNAVSCF
  • Length:  17(36-52)
  • Propeptide:  KRSTMLLNKLMQPLLRAFNADTELSHPPQMELRRRGEGKMFWRCYFNAVSCFRRRK
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-F0J9E4-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor000301_AF2.pdbhor000301_ESM.pdb

Physical Information

Mass: 233094 Formula: C94H129N23O23S3
Absent amino acids: DHILPQT Common amino acids: F
pI: 8.22 Basic residues: 2
Polar residues: 7 Hydrophobic residues: 6
Hydrophobicity: 12.35 Boman Index: -1355
Half-Life: 30 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 22.94
Instability Index: 3833.53 Extinction Coefficient cystines: 7115
Absorbance 280nm: 444.69

Literature

  • PubMed ID:  20888826
  • Title:  Identification of Chelicerate Neuropeptides Using Bioinformatics of Publicly Accessible Expressed Sequence Tags