General Information

  • ID:  hor000299
  • Uniprot ID:  P08934
  • Protein name:  Bradykinin
  • Gene name:  Kng1
  • Organism:  Rattus norvegicus (Rat)
  • Family:  Bradykinin family
  • Source:  Animal
  • Expression:  Plasma.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Rattus (genus), Murinae (subfamily), Muridae (family), Muroidea, Myomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0002020 protease binding; GO:0004869 cysteine-type endopeptidase inhibitor activity; GO:0030414 peptidase inhibitor activity
  • GO BP:  GO:0001938 positive regulation of endothelial cell proliferation; GO:0002542 Factor XII activation; GO:0006954 inflammatory response; GO:0007165 signal transduction; GO:0007204 positive regulation of cytosolic calcium ion concentration; GO:0007596 blood coagulation; GO:0007599 hemostasis; GO:0030195 negative regulation of blood coagulation; GO:0042130 negative regulation of T cell proliferation; GO:0042311 vasodilation; GO:0043410 positive regulation of MAPK cascade; GO:0045861 negative regulation of proteolysis; GO:0048146 positive regulation of fibroblast proliferation; GO:0050672 negative regulation of lymphocyte proliferation; GO:0097746 blood vessel diameter maintenance
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0043204 perikaryon

Sequence Information

  • Sequence:  RPPGFSPFR
  • Length:  9(381-389)
  • Propeptide:  MKLITILLLCSRLLPSLAQEEDAQEMDCNDESLFQAVDTALKKYNAGLKSGNQFVLYQVTEGTKKDGSKTFYSFKYQIKEGNCSVQSGFAWQDCDFKDAEEAATGECTATLEKRRNNKFSIATQICNITPGKGPIVTNEYHCLGCMHPISVDSPELGPVLKHAVEHFNNNTKHTHLFALGEVKSADRQVVAGMNYQIIYSIVQTNCSKEDFPSLHEDCVPLPSGDDGECKGNAFVDIHKTIAGFSDSCEFYPGDD
  • Signal peptide:  MKLITILLLCSRLLPSLA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Influence in smooth muscle contraction,induction of hypotension,natriuresis and diuresis,decrease in blood glucose level,it is a mediator of inflammation and causes ; increase in vascular permeability;stimulation of nociceptors ; release of other mediator
  • Mechanism:  Rats express four types of kininogens: the classical HMW/LMW kininogens and two additional LMW-like kininogens: T-I and T-II.
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  1744 seconds ( PubMed ID: 8395230 )

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P08934-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor000299_AF2.pdbhor000299_ESM.pdb

Physical Information

Mass: 120307 Formula: C50H73N15O11
Absent amino acids: ACDEHIKLMNQTVWY Common amino acids: P
pI: 12.5 Basic residues: 2
Polar residues: 2 Hydrophobic residues: 2
Hydrophobicity: -104.44 Boman Index: -2634
Half-Life / Aliphatic Index: 1 hour Aliphatic Index: 0
Instability Index: 12191.11 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  2413018##8395230
  • Title:  Primary Structures of the mRNAs Encoding the Rat Precursors for Bradykinin and T-kinin. Structural Relationship of Kininogens With Major Acute Phase Protein and Alpha 1-cysteine Proteinase Inhibitor