General Information

  • ID:  hor000297
  • Uniprot ID:  P01042
  • Protein name:  T-kinin
  • Gene name:  KNG1
  • Organism:  Homo sapiens (Human)
  • Family:  Bradykinin family
  • Source:  Human
  • Expression:  Secreted in plasma. T-kinin is detected in malignant ovarian, colon and breast carcinomas, but not in benign tumors.
  • Disease:  Diseases associated with KNG1 include High Molecular Weight Kininogen Deficiency and Angioedema, Hereditary, 6.
  • Comments:  NA
  • Taxonomy:  Homo (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0004869 cysteine-type endopeptidase inhibitor activity; GO:0005102 signaling receptor binding; GO:0005179 hormone activity; GO:0005515 protein binding; GO:0008201 heparin binding; GO:0008270 zinc ion binding; GO:0030414 peptidase inhibitor activity
  • GO BP:  GO:0006954 inflammatory response; GO:0007162 negative regulation of cell adhesion; GO:0007165 signal transduction; GO:0007204 positive regulation of cytosolic calcium ion concentration; GO:0007596 blood coagulation; GO:0007599 hemostasis; GO:0030195 negative regulation of blood coagulation; GO:0042311 vasodilation
  • GO CC:  NA

Sequence Information

  • Sequence:  ISLMKRPPGFSPFR
  • Length:  14(376-389)
  • Propeptide:  MKLITILFLCSRLLLSLTQESQSEEIDCNDKDLFKAVDAALKKYNSQNQSNNQFVLYRITEATKTVGSDTFYSFKYEIKEGDCPVQSGKTWQDCEYKDAAKAATGECTATVGKRSSTKFSVATQTCQITPAEGPVVTAQYDCLGCVHPISTQSPDLEPILRHGIQYFNNNTQHSSLFMLNEVKRAQRQVVAGLNFRITYSIVQTNCSKENFLFLTPDCKSLWNGDTGECTDNAYIDIQLRIASFSQNCDIYPGKD
  • Signal peptide:  MKLITILFLCSRLLLSLT
  • Modification:  T8 4-hydroxyproline
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Influence in smooth muscle contraction,induction of hypotension,natriuresis and diuresis,decrease in blood glucose level,it is a mediator of inflammation and causes ; increase in vascular permeability;stimulation of nociceptors ; release of other mediator
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P01042-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor000297_AF2.pdbhor000297_ESM.pdb

Physical Information

Mass: 186502 Formula: C76H121N21O17S
Absent amino acids: ACDEHNQTVWY Common amino acids: P
pI: 12.52 Basic residues: 3
Polar residues: 3 Hydrophobic residues: 4
Hydrophobicity: -27.86 Boman Index: -2310
Half-Life: 20 hour Half-Life Yeast: 30 min
Half-Life E.Coli: >10 hour Aliphatic Index 55.71
Instability Index: 10522.86 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  2076202
  • Title:  Ile-Ser-bradykinin is an aberrant permeability factor in various human malignant effusions.