General Information

  • ID:  hor000279
  • Uniprot ID:  P24393
  • Protein name:  Gastrin-releasing peptide
  • Gene name:  GRP
  • Organism:  Rattus norvegicus (Rat)
  • Family:  Bombesin/neuromedin-B/ranatensin family
  • Source:  Animal
  • Expression:  Expressed in several dozen cells in the dorsal retrotrapezoid nucleus/parafacial respiratory group (at protein level).
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Rattus (genus), Murinae (subfamily), Muridae (family), Muroidea, Myomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005184 neuropeptide hormone activity
  • GO BP:  GO:0001503 ossification; GO:0007218 neuropeptide signaling pathway; GO:0010468 regulation of gene expression; GO:0035176 social behavior; GO:0036343 psychomotor behavior; GO:0043207 response to external biotic stimulus; GO:0043303 mast cell degranulation; GO:0090277 positive regulation of peptide hormone secretion; GO:1900738 positive regulation of phospholipase C-activating G protein-coupled receptor signaling pathway; GO:1903817 negative regulation of voltage-gated potassium channel activity; GO:1903942 positive regulation of respiratory gaseous exchange; GO:1904384 cellular response to sodium phosphate; GO:1905151 negative regulation of voltage-gated sodium channel activity; GO:1905461 positive regulation of vascular associated smooth muscle cell apoptotic process; GO:2000987 positive regulation of behavioral fear response
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0031410 cytoplasmic vesicle; GO:0034774 secretory granule lumen; GO:0042995 cell projection; GO:0043005 neuron projection; GO:0098992 neuronal dense core vesicle

Sequence Information

  • Sequence:  APVSTGAGGGTVLAKMYPRGSHWAVGHLM
  • Length:  29(24-52)
  • Propeptide:  MRGSELSLLLLALVLCQAPRGPAAPVSTGAGGGTVLAKMYPRGSHWAVGHLMGKKSTDELPPLYAADRDGLKEQLRGYIRWEEAARNLLGLLEAAGNRSHQPPQDQPLGSLQPTWDPEDGSYFSDAQNAKLVDSLLQVLKGKEGTAS
  • Signal peptide:  MRGSELSLLLLALVLCQAPRGPA
  • Modification:  T29 Methionine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Has a role in food intake, circadian rhythm generation, fear memory, itch sensation and sexual behaviour
  • Mechanism:  Gastrin-releasing peptide acts via postsynaptic bombesin type 2 receptors to modulate inward rectifier K+ and TRPV1-like conductances in rat paraventricular thalamic neurons.
  • Cross BBB:  NA
  • Target:  Grpr
  • Target Unid:   P52500
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P24393-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor000279_AF2.pdbhor000279_ESM.pdb

Physical Information

Mass: 340900 Formula: C129H202N38O35S2
Absent amino acids: CDEFINQ Common amino acids: G
pI: 10.45 Basic residues: 4
Polar residues: 11 Hydrophobic residues: 10
Hydrophobicity: 19.31 Boman Index: 0
Half-Life / Aliphatic Index: 4.4 hour Aliphatic Index: 70.69
Instability Index: 3169.66 Extinction Coefficient cystines: 6990
Absorbance 280nm: 249.64

Literature

  • PubMed ID:  12419521
  • Title:  Gastrin-releasing Peptide Microinjected Into the Amygdala Inhibits Feeding.
  • PubMed ID:  23359674
  • Title:  Gastrin-releasing Peptide Acts via Postsynaptic BB2 Receptors to Modulate Inward Rectifier K+ and TRPV1-like Conductances in Rat Paraventricular Thalamic Neurons