General Information

  • ID:  hor000277
  • Uniprot ID:  P08949
  • Protein name:  Neuromedin-B-32
  • Gene name:  NMB
  • Organism:  Homo sapiens (Human)
  • Family:  Bombesin/neuromedin-B/ranatensin family
  • Source:  Human
  • Expression:  Up-regulated in response to infection with influenza A virus.
  • Disease:  Diseases associated with NMB include Gastrinoma and Lung Cancer.
  • Comments:  NA
  • Taxonomy:  Homo (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity; GO:0005515 protein binding; GO:0031710 neuromedin B receptor binding
  • GO BP:  GO:0002376 immune system process; GO:0007165 signal transduction; GO:0007204 positive regulation of cytosolic calcium ion concentration; GO:0007218 neuropeptide signaling pathway; GO:0007267 cell-cell signaling; GO:0008284 positive regulation of cell population proliferation; GO:0032715 negative regulation of interleukin-6 production; GO:0032727 positive regulation of interferon-alpha production; GO:0045087 innate immune response; GO:0046887 positive regulation of hormone secretion; GO:0046888 negative regulation of hormone secretion; GO:0050482 arachidonic acid secretion; GO:0090290 positive regulation of osteoclast proliferation; GO:0140374 antiviral innate immune response; GO:0160023 sneeze reflex; GO:0160024 Leydig cell proliferation; GO:0160025 sensory perception of itch; GO:1903942 positive regulation of respiratory gaseous exchange; GO:2000845 positive regulation of testosterone secretion
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0042995 cell projection; GO:0043005 neuron projection

Sequence Information

  • Sequence:  APLSWDLPEPRSRASKIRVHSRGNLWATGHFM
  • Length:  32
  • Propeptide:  MARRAGGARMFGSLLLFALLAAGVAPLSWDLPEPRSRASKIRVHSRGNLWATGHFMGKKSLEPSSPSPLGTAPHTSLRDQRLQLSHDLLGILLLKKALGVSLSRPAPQIQYRRLLVQILQK
  • Signal peptide:  MARRAGGARMFGSLLLFALLAAGV
  • Modification:  T32 Methionine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Anorexic effects
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NMBR
  • Target Unid:  P28336
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P08949-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor000277_AF2.pdbhor000277_ESM.pdb

Physical Information

Mass: 422731 Formula: C164H254N52O43S
Absent amino acids: CQY Common amino acids: RS
pI: 12.05 Basic residues: 7
Polar residues: 8 Hydrophobic residues: 11
Hydrophobicity: -62.19 Boman Index: -7187
Half-Life: 4.4 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 67.19
Instability Index: 4543.75 Extinction Coefficient cystines: 11000
Absorbance 280nm: 354.84

Literature

  • PubMed ID:  15585758
  • Title:  Neuromedin Beta: A Strong Candidate Gene Linking Eating Behaviors and Susceptibility to Obesity