HORDB

General Information

ID: hor000275
Uniprot ID: P07492
Protein name: Gastrin-releasing peptide
Gene name: GRP
Organism: Homo sapiens (Human)
Family: Bombesin/neuromedin-B/ranatensin family
Source: Human
Expression: NA
Disease: Diseases associated with GRP include Duodenal Ulcer and Diffuse Pulmonary Fibrosis.
Comments: NA
Taxonomy: Homo (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0005102 signaling receptor binding; GO:0005184 neuropeptide hormone activity; GO:0005515 protein binding
GO BP: GO:0001503 ossification; GO:0007165 signal transduction; GO:0007218 neuropeptide signaling pathway; GO:0010468 regulation of gene expression; GO:0035176 social behavior; GO:0036343 psychomotor behavior; GO:0043207 response to external biotic stimulus; GO:0043303 mast cell degranulation; GO:0090277 positive regulation of peptide hormone secretion; GO:1900738 positive regulation of phospholipase C-activating G protein-coupled receptor signaling pathway; GO:1903817 negative regulation of voltage-gated potassium channel activity; GO:1903942 positive regulation of respiratory gaseous exchange; GO:1904384 cellular response to sodium phosphate; GO:1905151 negative regulation of voltage-gated sodium channel activity; GO:1905461 positive regulation of vascular associated smooth muscle cell apoptotic process; GO:2000987 positive regulation of behavioral fear response
GO CC: GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0031410 cytoplasmic vesicle; GO:0034774 secretory granule lumen; GO:0042995 cell projection; GO:0043005 neuron projection; GO:0098992 neuronal dense core vesicle

Sequence Information

Sequence: VPLPAGGGTVLTKMYPRGNHWAVGHLM
Length: 27
Propeptide: MRGRELPLVLLALVLCLAPRGRAVPLPAGGGTVLTKMYPRGNHWAVGHLMGKKSTGESSSVSERGSLKQQLREYIRWEEAARNLLGLIEAKENRNHQPPQPKALGNQQPSWDSEDSSNFKDVGSKGKVGRLSAPGSQREGRNPQLNQQ
Signal peptide: MRGRELPLVLLALVLCLAPRGRA
Modification: T27 Methionine amide
Glycosylation: NA
Mutagenesis: NA

Activity

Function: Play a transient and non-critical role in intestinal development;triggers the growth of HepG2 cells;Stimulates the release of gastrin and other gastrointestinal hormones
Mechanism: GRP triggers the growth of HepG2 cells through blocking the ER stress-mediated pathway.
Cross BBB: NA
Target: GRPR
Target Unid: P30550
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: 2.8±0.4 min minute; /168 seconds ( PubMed ID: 6736205 )

Structure

Disulfide bond: NA
Structure ID: AF-P10092-F1(AlphaFold_DB_ID)

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

AF-P10092-F1.pdb

hor000275_AF2.pdb

hor000275_ESM.pdb

Physical Information

Mass:	332434	Formula:	C130H203N37O32S2
Absent amino acids:	CDEFIQS	Common amino acids:	G
pI:	10.45	Basic residues:	4
Polar residues:	9	Hydrophobic residues:	9
Hydrophobicity:	10	Boman Index:	52
Half-Life:	100 hour	Half-Life Yeast:	>20 hour
Half-Life E.Coli:	>10 hour	Aliphatic Index	82.96
Instability Index:	4358.15	Extinction Coefficient cystines:	6990
Absorbance 280nm:	268.85

Literature

PubMed ID: 3211139
Title: Posttranslational Processing of Endogenous and of Baculovirus-Expressed Human Gastrin-Releasing Peptide Precursor.
PubMed ID: 11960700
Title: Contribution of Gastrin-Releasing Peptide and Its Receptor to Villus Development in the Murine and Human Gastrointestinal Tract
PubMed ID: 6736205
Title: