General Information

  • ID:  hor000274
  • Uniprot ID:  P07492
  • Protein name:  Neuromedin-C
  • Gene name:  GRP
  • Organism:  Homo sapiens (Human)
  • Family:  Bombesin/neuromedin-B/ranatensin family
  • Source:  Human
  • Expression:  NA
  • Disease:  Diseases associated with GRP include Duodenal Ulcer and Diffuse Pulmonary Fibrosis.
  • Comments:  NA
  • Taxonomy:  Homo (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005102 signaling receptor binding; GO:0005184 neuropeptide hormone activity; GO:0005515 protein binding
  • GO BP:  GO:0001503 ossification; GO:0007165 signal transduction; GO:0007218 neuropeptide signaling pathway; GO:0010468 regulation of gene expression; GO:0035176 social behavior; GO:0036343 psychomotor behavior; GO:0043207 response to external biotic stimulus; GO:0043303 mast cell degranulation; GO:0090277 positive regulation of peptide hormone secretion; GO:1900738 positive regulation of phospholipase C-activating G protein-coupled receptor signaling pathway; GO:1903817 negative regulation of voltage-gated potassium channel activity; GO:1903942 positive regulation of respiratory gaseous exchange; GO:1904384 cellular response to sodium phosphate; GO:1905151 negative regulation of voltage-gated sodium channel activity; GO:1905461 positive regulation of vascular associated smooth muscle cell apoptotic process; GO:2000987 positive regulation of behavioral fear response
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0031410 cytoplasmic vesicle; GO:0034774 secretory granule lumen; GO:0042995 cell projection; GO:0043005 neuron projection; GO:0098992 neuronal dense core vesicle

Sequence Information

  • Sequence:  GNHWAVGHLM
  • Length:  10
  • Propeptide:  MRGRELPLVLLALVLCLAPRGRAVPLPAGGGTVLTKMYPRGNHWAVGHLMGKKSTGESSSVSERGSLKQQLREYIRWEEAARNLLGLIEAKENRNHQPPQPKALGNQQPSWDSEDSSNFKDVGSKGKVGRLSAPGSQREGRNPQLNQQ
  • Signal peptide:  MRGRELPLVLLALVLCLAPRGRA
  • Modification:  T10 Methionine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Stimulates smooth muscle contraction in a manner similar to that of bombesin.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  GRPR
  • Target Unid:  P30550
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  2n0b(PDB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    2n0b.pdbhor000274_AF2.pdbhor000274_ESM.pdb

Physical Information

Mass: 128201 Formula: C50H72N16O12S
Absent amino acids: CDEFIKPQRSTY Common amino acids: GH
pI: 7.72 Basic residues: 2
Polar residues: 3 Hydrophobic residues: 4
Hydrophobicity: 1 Boman Index: 137
Half-Life: 30 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 78
Instability Index: -2589 Extinction Coefficient cystines: 5500
Absorbance 280nm: 611.11

Literature

  • PubMed ID:  NA
  • Title:  Conformational ensembles of neuromedin C reveal a progressive coil-helix transition within a binding-induced folding mechanism.