General Information

  • ID:  hor000272
  • Uniprot ID:  Q2T9U8
  • Protein name:  Neuromedin-B
  • Gene name:  NMB
  • Organism:  Bos taurus (Bovine)
  • Family:  Bombesin/neuromedin-B/ranatensin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Bos (genus), Bovinae (subfamily), Bovidae (family), Pecora (infraorder), Ruminantia (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005184 neuropeptide hormone activity; GO:0031710 neuromedin B receptor binding
  • GO BP:  GO:0002376 immune system process; GO:0007218 neuropeptide signaling pathway; GO:0032715 negative regulation of interleukin-6 production; GO:0032727 positive regulation of interferon-alpha production; GO:0045087 innate immune response; GO:0046887 positive regulation of hormone secretion; GO:0090290 positive regulation of osteoclast proliferation; GO:0140374 antiviral innate immune response; GO:0160023 sneeze reflex; GO:0160024 Leydig cell proliferation; GO:0160025 sensory perception of itch; GO:1903942 positive regulation of respiratory gaseous exchange; GO:2000845 positive regulation of testosterone secretion
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0042995 cell projection; GO:0043005 neuron projection

Sequence Information

  • Sequence:  GNLWATGHFM
  • Length:  10(47-56)
  • Propeptide:  MTLRAVGVRLLGGLLLFALLAAGAAPLGWDLPESRSRASKIRVHPRGNLWATGHFMGKKSLEPPSPSLLGTAPHTSLRDQTPQLSHHLLRVLLQKQALGMSLSVPAPNTQHRRLLVQTLQK
  • Signal peptide:  MTLRAVGVRLLGGLLLFALLAAGA
  • Modification:  T10 Methionine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Stimulates smooth muscle contraction in a manner similar to that of bombesin
  • Mechanism:  NA
  • Cross BBB:  YES
  • Target:  NMBR
  • Target Unid:   E1BMN4
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q2T9U8-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor000272_AF2.pdbhor000272_ESM.pdb

Physical Information

Mass: 129401 Formula: C52H72N14O13S
Absent amino acids: CDEIKPQRSVY Common amino acids: G
pI: 7.55 Basic residues: 1
Polar residues: 4 Hydrophobic residues: 4
Hydrophobicity: 12 Boman Index: 240
Half-Life / Aliphatic Index: 30 hour Aliphatic Index: 49
Instability Index: -970 Extinction Coefficient cystines: 5500
Absorbance 280nm: 611.11

Literature

  • PubMed ID:  NA
  • Title:  NA