General Information

  • ID:  hor000271
  • Uniprot ID:  Q863C3
  • Protein name:  Neuromedin-C
  • Gene name:  GRP
  • Organism:  Bos taurus (Bovine)
  • Family:  Bombesin/neuromedin-B/ranatensin family
  • Source:  animal
  • Expression:  Detected in adrenal medulla (at protein level).
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Bos (genus), Bovinae (subfamily), Bovidae (family), Pecora (infraorder), Ruminantia (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005184 neuropeptide hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway; GO:0043303 mast cell degranulation; GO:0048565 digestive tract development; GO:0090277 positive regulation of peptide hormone secretion; GO:1900738 positive regulation of phospholipase C-activating G protein-coupled receptor signaling pathway; GO:1903817 negative regulation of voltage-gated potassium channel activity; GO:1903942 positive regulation of respiratory gaseous exchange; GO:1905151 negative regulation of voltage-gated sodium channel activity; GO:2000987 positive regulation of behavioral fear response
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0031410 cytoplasmic vesicle; GO:0034774 secretory granule lumen; GO:0042995 cell projection; GO:0043005 neuron projection

Sequence Information

  • Sequence:  GNHWAVGHLM
  • Length:  10
  • Propeptide:  MRGREVPLVLLALVLCLAPRGWAAPVTAGRGGALAKMYTRGNHWAVGHLMGKKSVAESPQLHEEESLKEQLREYAQWEEATRNLLSLLQAKGARGHQMPPWEPLSIHQPAWDSEDVSNFKDTGPQHEGRNPQLN
  • Signal peptide:  MRGREVPLVLLALVLCLAPRGWA
  • Modification:  T10 Methionine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Be secreted and stimulate adjacent cells or splanchnic nerve terminals
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  GRPR
  • Target Unid:  E1BL07
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q863C3-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor000271_AF2.pdbhor000271_ESM.pdb

Physical Information

Mass: 128201 Formula: C50H72N16O12S
Absent amino acids: CDEFIKPQRSTY Common amino acids: GH
pI: 7.72 Basic residues: 2
Polar residues: 3 Hydrophobic residues: 4
Hydrophobicity: 1 Boman Index: 137
Half-Life: 30 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 78
Instability Index: -2589 Extinction Coefficient cystines: 5500
Absorbance 280nm: 611.11

Literature

  • PubMed ID:  2755876
  • Title:  Structural Identification, Subcellular Localization and Secretion of Bovine Adrenomedullary Neuromedin C [GRP-(18-27)]