General Information

  • ID:  hor000269
  • Uniprot ID:  P01297
  • Protein name:  Neuromedin-B-30
  • Gene name:  NMB
  • Organism:  Sus scrofa (Pig)
  • Family:  Bombesin/neuromedin-B/ranatensin family
  • Source:  animal
  • Expression:  During the sow estrus cycle, highest levels are found in the hypothalamus during proestrus, decrease during estrus and metestrus and increase again during diestrus. In the pituitary gland, levels decrease from proestrus to estrus, increase at metestrus an
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Sus (genus), Suidae (family), Suina (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0002376 immune system process; GO:0007218 neuropeptide signaling pathway; GO:0032715 negative regulation of interleukin-6 production; GO:0032727 positive regulation of interferon-alpha production; GO:0045087 innate immune response; GO:0090290 positive regulation of osteoclast proliferation; GO:0140374 antiviral innate immune response; GO:0160023 sneeze reflex; GO:0160024 Leydig cell proliferation; GO:0160025 sensory perception of itch; GO:1903942 positive regulation of respiratory gaseous exchange; GO:2000845 positive regulation of testosterone secretion
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0042995 cell projection; GO:0043005 neuron projection

Sequence Information

  • Sequence:  LSWDLPEPRSRAGKIRVHPRGNLWATGHFM
  • Length:  30
  • Propeptide:  MTLRARGARLLGGLLFFTLLAAGAAPLSWDLPEPRSRAGKIRVHPRGNLWATGHFMGKKSLEPPNPSLLGTTHHISLRDQRLQLSHDLLRILLQKKALGLSLSGPASHTPYRRLLVQTLEK
  • Signal peptide:  MTLRARGARLLGGLLFFTLLAAGA
  • Modification:  T30 Methionine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Stimulates smooth muscle contraction in a manner similar to that of bombesin.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  GRPR
  • Target Unid:  K7GR81
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P01297-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor000269_AF2.pdbhor000269_ESM.pdb

Physical Information

Mass: 400346 Formula: C157H242N50O39S
Absent amino acids: CQY Common amino acids: R
pI: 12.05 Basic residues: 7
Polar residues: 7 Hydrophobic residues: 10
Hydrophobicity: -68.33 Boman Index: -6594
Half-Life: 5.5 hour Half-Life Yeast: 3 min
Half-Life E.Coli: 2 min Aliphatic Index 68.33
Instability Index: 2865.67 Extinction Coefficient cystines: 11000
Absorbance 280nm: 379.31

Literature

  • PubMed ID:  4026853
  • Title:  Neuromedin B-32 and B-31: Two "Big" Neuromedin B Identified in Porcine Brain and Spinal Cord