General Information

  • ID:  hor000267
  • Uniprot ID:  P47851
  • Protein name:  Gastrin-releasing peptide
  • Gene name:  grp
  • Organism:  Ovis aries (Sheep)
  • Family:  Bombesin/neuromedin-B/ranatensin family
  • Source:  Animal
  • Expression:  Brain and stomach.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Ovis (genus), Caprinae (subfamily), Bovidae (family), Pecora (infraorder), Ruminantia (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007218 neuropeptide signaling pathway; GO:0043303 mast cell degranulation; GO:0090277 positive regulation of peptide hormone secretion; GO:1900738 positive regulation of phospholipase C-activating G protein-coupled receptor signaling pathway; GO:1903817 negative regulation of voltage-gated potassium channel activity; GO:1903942 positive regulation of respiratory gaseous exchange; GO:1905151 negative regulation of voltage-gated sodium channel activity; GO:2000987 positive regulation of behavioral fear response
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0031410 cytoplasmic vesicle; GO:0034774 secretory granule lumen; GO:0042995 cell projection; GO:0043005 neuron projection

Sequence Information

  • Sequence:  APVTAGRAGALAKMYTRGNHWAVGHLM
  • Length:  27(24-50)
  • Propeptide:  MRSREVSLVLLALVLCPAPRGSAAPVTAGRAGALAKMYTRGNHWAVGHLMGKKSVAESPQLREEESLKEQLREYAQWEEATRNLLSLLQAKVAQGHQPPRWEPLSIHQPAWDSKDVSNFKDSGSQREGGNPQLY
  • Signal peptide:  MRSREVSLVLLALVLCPAPRGSA
  • Modification:  T27 Methionine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  May play an important but hitherto unrecognized role in utero-placental development and possibly in fetal development after transfer to the fetus.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NMBR
  • Target Unid:   W5NT48
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P47851-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor000267_AF2.pdbhor000267_ESM.pdb

Physical Information

Mass: 330128 Formula: C125H198N40O32S2
Absent amino acids: CDEFIQS Common amino acids: A
pI: 11.53 Basic residues: 5
Polar residues: 8 Hydrophobic residues: 11
Hydrophobicity: 3.7 Boman Index: -1706
Half-Life / Aliphatic Index: 4.4 hour Aliphatic Index: 72.59
Instability Index: 1924.07 Extinction Coefficient cystines: 6990
Absorbance 280nm: 268.85

Literature

  • PubMed ID:  7988429
  • Title:  Gastrin-releasing peptide is produced in the pregnant ovine uterus.