General Information

  • ID:  hor000266
  • Uniprot ID:  P29007
  • Protein name:  Neuromedin-C
  • Gene name:  grp
  • Organism:  Bombina orientalis (Oriental fire-bellied toad)
  • Family:  Bombesin/neuromedin-B/ranatensin family
  • Source:  animal
  • Expression:  Brain and stomach. In the stomach GRP was localized, at the base of the gastric pits, to occasional cells whose distribution and appearance were consistent with that of gut neuroendocrine cells.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Bombina (genus), Bombinatoridae (family), Anura (order), Batrachia (superorder), Amphibia (class), Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007218 neuropeptide signaling pathway; GO:0090277 positive regulation of peptide hormone secretion; GO:1900738 positive regulation of phospholipase C-activating G protein-coupled receptor signaling pathway
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0031410 cytoplasmic vesicle; GO:0034774 secretory granule lumen

Sequence Information

  • Sequence:  GSHWAVGHLM
  • Length:  10
  • Propeptide:  MEGVLLFWKYRALFFLVLCSLVLCKVHLSQASPTSQQHNDAASLSKIYPRGSHWAVGHLMGKKSIEEYPYAYDEADRSSAAVFSEGDKPSDGYQQWKESLLNLLKMIEVNEYRNSKAMREASVYNKKFSGAEDNNLKEMLDYLYQMMNMKENTSS
  • Signal peptide:  MEGVLLFWKYRALFFLVLCSLVLCKVHLSQA
  • Modification:  T10 Methionine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Stimulates the release of gastrin and other gastrointestinal hormones
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P29007-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor000266_AF2.pdbhor000266_ESM.pdb

Physical Information

Mass: 125498 Formula: C49H71N15O12S
Absent amino acids: CDEFIKNPQRTY Common amino acids: GH
pI: 7.72 Basic residues: 2
Polar residues: 3 Hydrophobic residues: 4
Hydrophobicity: 28 Boman Index: 461
Half-Life: 30 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 78
Instability Index: -1740 Extinction Coefficient cystines: 5500
Absorbance 280nm: 611.11

Literature

  • PubMed ID:  1551901
  • Title:  Gastrin-releasing Peptide (GRP) Is Not Mammalian Bombesin. Identification and Molecular Cloning of a True Amphibian GRP Distinct From Amphibian Bombesin in Bombina Orientalis