General Information

  • ID:  hor000263
  • Uniprot ID:  A0A8C2T027
  • Protein name:  Gastrin-releasing peptide
  • Gene name:  GRP
  • Organism:  Coturnix japonica (Japanese quail) (Coturnix coturnix japonica)
  • Family:  Bombesin/neuromedin-B/ranatensin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  exhibit sex differences
  • Taxonomy:  Coturnix (genus), Perdicinae (subfamily), Phasianidae (family), Galliformes (order), Galloanserae (superorder), Neognathae (infraclass), Aves (class), Coelurosauria, Theropoda, Saurischia, Dinosauria, Archosauria, Archelosauria, Sauria, Sauropsida, Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  APLQPGGSPALTKIYP
  • Length:  16
  • Propeptide:  MGCGGPRRPGALPLLALLALLAAQGGAAPLQPGGSPALTKIYPRGSHWAVGHLMGKKSTGDIPYAYEEENKNPFSASPENVKQLDDYLQREEMSKHLLQLLEGNENKSAHFSKGELPWHTRNSGETDDSSSWKDYLLQAVNMKDSTPS
  • Signal peptide:  MGCGGPRRPGALPLLALLALLAAQGGA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor000263_AF2.pdbhor000263_ESM.pdb

Physical Information

Mass: 187762 Formula: C75H120N18O21
Absent amino acids: CDEFHMNRVW Common amino acids: P
pI: 9.3 Basic residues: 1
Polar residues: 5 Hydrophobic residues: 5
Hydrophobicity: -10.63 Boman Index: 306
Half-Life: 4.4 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 85.63
Instability Index: 10344.38 Extinction Coefficient cystines: 1490
Absorbance 280nm: 99.33

Literature

  • PubMed ID:  20298575
  • Title:  Neuropeptidomic Analysis of the Embryonic Japanese Quail Diencephalon