General Information

  • ID:  hor000240
  • Uniprot ID:  E7ELP6
  • Protein name:  Pigment dispersing hormone
  • Gene name:  NA
  • Organism:  Daphnia pulex (Water flea)
  • Family:  Arthropod PDH family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Daphnia (genus), Daphniidae (family), Anomopoda (infraorder), Cladocera (suborder), Diplostraca (order), Phyllopoda (subclass), Branchiopoda (class), Crustacea (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction; GO:0007268 chemical synaptic transmission; GO:0009416 response to light stimulus
  • GO CC:  GO:0005576 extracellular region; GO:0045202 synapse

Sequence Information

  • Sequence:  NSELINSLLGLPRFMKVV
  • Length:  18(151-168)
  • Propeptide:  MHQLSAKLSHLSIALFVLLVSFATDAESAPPSISSNNRPEAQMSIQEMEKFLEGLTRYLHRQHLDLPKVHQQSQEEQQPGSYEADAIDRSGDMSAPTEAERSSSSSELANHSLSHPRPPMANKWPWSLSHLERIEDDPDFKERQQPYAKRNSELINSLLGLPRFMKVVG
  • Signal peptide:  MHQLSAKLSHLSIALFVLLVSFATDAES
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Induces light-adaptive movement of pigment in distal eye pigment cells and?pigment dispersion
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-E7ELP6-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor000240_AF2.pdbhor000240_ESM.pdb

Physical Information

Mass: 233386 Formula: C92H156N24O25S
Absent amino acids: ACDHQTWY Common amino acids: L
pI: 9.69 Basic residues: 2
Polar residues: 5 Hydrophobic residues: 8
Hydrophobicity: 57.22 Boman Index: -841
Half-Life: 1.4 hour Half-Life Yeast: 3 min
Half-Life E.Coli: >10 hour Aliphatic Index 140.56
Instability Index: 2093.89 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  21830762
  • Title:  Genomics, Transcriptomics, and Peptidomics of Daphnia Pulex Neuropeptides and Protein Hormones