General Information

  • ID:  hor000232
  • Uniprot ID:  Q7Z262
  • Protein name:  Pigment-dispersing factor
  • Gene name:  pdf
  • Organism:  Gryllus bimaculatus (Two-spotted cricket)
  • Family:  Arthropod PDH family
  • Source:  Animal
  • Expression:  sinus gland
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Gryllus (genus), Gryllinae (subfamily), Gryllidae (family), Grylloidea (superfamily), Gryllidea (infraorder), Ensifera (suborder), Orthoptera (order), Polyneoptera (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway; GO:0009416 response to light stimulus
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  NSEIINSLLGLPKVLNDA
  • Length:  18(23-40)
  • Propeptide:  MARRARFEANAAPSPLMCVHKRNSEIINSLLGLPKVLNDAGRK
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  The phase shifting effects on the circadian activity rhythm
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q7Z262-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor000232_AF2.pdbhor000232_ESM.pdb

Physical Information

Mass: 221362 Formula: C84H144N22O28
Absent amino acids: CFHMQRTWY Common amino acids: L
pI: 4.18 Basic residues: 1
Polar residues: 6 Hydrophobic residues: 8
Hydrophobicity: 28.89 Boman Index: -1149
Half-Life / Aliphatic Index: 1.4 hour Aliphatic Index: 151.67
Instability Index: 3582.78 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  14624032
  • Title:  Phase Shifts of the Circadian Locomotor Rhythm Induced by Pigment-Dispersing Factor in the Cricket Gryllus Bimaculatus