General Information

  • ID:  hor000222
  • Uniprot ID:  O97387
  • Protein name:  CHH precursor-related peptide 5
  • Gene name:  CHH5
  • Organism:  Penaeus monodon (Giant tiger prawn)
  • Family:  Arthropod CHH/MIH/GIH/VIH hormone family
  • Source:  Animal
  • Expression:  medulla terminalis X-organ in the eyestalks
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Penaeus (genus), Penaeidae (family), Penaeoidea (superfamily), Dendrobranchiata (suborder), Decapoda (order), Eucarida (superorder), Eumalacostraca (subclass), Malacostraca (class), Multicrustacea (superclass), Crustacea (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity
  • GO BP:  GO:0005975 carbohydrate metabolic process; GO:0006006 glucose metabolic process; GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  RSLEGSSSPVASLIRGRSLS
  • Length:  20(27-46)
  • Propeptide:  MSLGLIASRLVAVALVVVVACSTTWARSLEGSSSPVASLIRGRSLSKRANFDPSCAGVYDRELLGGLSRLCDDCYNVFREPKVATECRSNCFYNSVFVQCLEYLIPADLHEEYQAHVQTVGK
  • Signal peptide:  MSLGLIASRLVAVALVVVVACSTTWA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Hormone found in the sinus gland of isopods and decapods which controls the blood sugar level. Has a secretagogue action over the amylase released from the midgut gland. May act as a stress hormone and may be involved in the control of molting and reprodu
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-O97387-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor000222_AF2.pdbhor000222_ESM.pdb

Physical Information

Mass: 239836 Formula: C85H151N29O30
Absent amino acids: CDFHKMNQTWY Common amino acids: S
pI: 12.2 Basic residues: 3
Polar residues: 9 Hydrophobic residues: 6
Hydrophobicity: -15.5 Boman Index: -4796
Half-Life: 1 hour Half-Life Yeast: 2 min
Half-Life E.Coli: 2 min Aliphatic Index 97.5
Instability Index: 10005.5 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  10804243
  • Title:  Five Crustacean Hyperglycemic Family Hormones of Penaeus Monodon: Complementary DNA Sequence and Identification in Single Sinus Glands by Electrospray Ionization-Fourier Transform Mass Spectrometry